(data stored in ACNUC7421 zone)

EMBL: CP000690.PE135

CP000690.PE135       Location/Qualifiers
FT   CDS_pept        147715..148842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3434"
FT                   /product="phage integrase domain protein SAM domain
FT                   protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3434"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29039"
FT                   /db_xref="GOA:A5FTV7"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV7"
FT                   /protein_id="ABQ29039.1"
FT                   /translation="MPDDTEFAPQDRPDAPSAGSLVPSPPPLAGDGHAVRRWFSEIEDE
FT                   PVPVADGTLAGARSAASAYARRAKADNTRRAYRAAVRVWCLWCDRHGLTPLPASGADVA
FT                   AFLADERGRGVSTETLKLRRAAIRYLHRLAGCPVPTDDACVAETMAGIQRDAASRGEIR
FT                   RKKVAATATVIRRLLAPIGDTELTDLRDRALILVGFAGALRRSELAGIRIEHLTPSERG
FT                   LRLTLPQTKGSQAEAVTVALPYGDTELCPVHALERWRVAAGLQRGPLFRRIWSPPSGRK
FT                   GRERTAPPGPVIGERALTPQSVALIIQRRAMAAGFGRRDLGGHSLKRGALTTGMERGVH
FT                   PARLKRLGRHKSYDVLGEYLEFGDLFDGHPLDGVL"
     gtgcccgatg acaccgaatt cgcaccgcaa gaccgccccg acgcgccatc ggccggcagc        60
     ctggtgccct ccccgccccc gctcgccggc gacgggcacg cggtccggcg ctggttcagc       120
     gagatcgagg acgaaccggt cccggtggcc gatggcacgc tcgccggcgc ccgcagcgcc       180
     gccagcgcct atgcccgtcg ggccaaggcg gacaacacca ggcgggccta ccgcgcggcg       240
     gtgcgcgtct ggtgcctctg gtgcgaccgc cacgggctga cgcccctccc cgcctccggc       300
     gcggatgtcg ccgccttcct cgccgatgag cgcggccgcg gcgtctcgac cgaaacgctc       360
     aagctccggc gcgccgccat ccgctacctg catcgcctcg ccggctgccc ggtgcccacc       420
     gatgatgcct gcgtcgccga gaccatggcg ggcatccagc gtgacgccgc ctcccgtggc       480
     gagatccgcc gcaagaaggt ggcggcgacg gcgacggtga tccgccggct gctggcaccg       540
     atcggcgata ccgagctgac tgacctgcgc gaccgcgcgc tgatcctggt cggcttcgcc       600
     ggcgcgctgc ggcgctcgga actcgccggc atcaggatcg agcacctgac accgtcagag       660
     cggggactcc gcctgaccct gccgcagaca aaagggagcc aggccgaggc ggtcaccgtc       720
     gccctgccct acggcgatac cgaactctgt ccggtgcatg cccttgagcg ctggcgggtc       780
     gccgcggggc tgcagcgggg cccgttgttc cgtcggatct ggtctccgcc atccggccgc       840
     aaggggcgcg agcggaccgc gccgcctggg ccggtcatcg gcgagcgggc cctcaccccg       900
     caaagcgtgg ccctgatcat ccagcgccgg gccatggcgg ccgggttcgg ccggcgcgac       960
     ctgggcgggc acagcctcaa gcgcggggcg ctgaccaccg ggatggagcg cggcgtccat      1020
     ccggcgcgcc tgaagcggct cggccgccac aagagctatg acgtgctcgg ggagtacctg      1080
     gagttcggcg acctgtttga cgggcacccg ctggatgggg tgctctaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page