(data stored in ACNUC7421 zone)

EMBL: CP000690.PE136

CP000690.PE136       Location/Qualifiers
FT   CDS_pept        complement(149342..149917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29040"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV8"
FT                   /protein_id="ABQ29040.1"
FT                   /translation="MVTTTVSKAATRTPSGPKANKPSHKAPKTSRALKVPMTSPGSPAA
FT                   KGGTDVSYLEYFYQAPMRQIEMIRRGIPALTVKRIAGDLRIEQDTLLRALNLSVATLNR
FT                   KVAQAKNLPADESERIAGIARLVGQVEAMVKESGDPEGFNAAEWLSRWLREPLPALGGQ
FT                   MPIKLLDTMAGQALVSQALSRIQSGAYA"
     atggttacca cgactgtgag caaagccgcg accagaacac cttcaggtcc gaaggcaaac        60
     aagccttcgc acaaggcccc caagacatct cgcgcgctta aggttcccat gacatcaccc       120
     ggatccccgg cggcaaaagg tgggaccgat gtgtcctacc tggaatactt ttatcaggcg       180
     cctatgcgcc aaatcgagat gatcaggagg gggattcccg cgctcaccgt aaagcggatc       240
     gcaggtgatc tcaggatcga gcaggacact ttgctccgtg cgctcaacct gagtgtagcc       300
     accctgaatc gaaaggtcgc ccaggcgaag aatctgccgg ccgatgagag cgagcgcatt       360
     gccggtattg cgcgactggt ggggcaggtc gaggcgatgg tgaaggaatc cggtgatcca       420
     gagggattta acgccgcaga atggctctcg cgctggttgc gcgagccatt gccagcgctc       480
     ggcggtcaga tgcctatcaa attgcttgac acgatggcgg ggcaagccct cgtctcacag       540
     gcattgtccc gcattcagag cggggcctat gcgtga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page