(data stored in ACNUC7421 zone)

EMBL: CP000690.PE137

CP000690.PE137       Location/Qualifiers
FT   CDS_pept        150068..150529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3437"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29041"
FT                   /db_xref="GOA:A5FTV9"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTV9"
FT                   /protein_id="ABQ29041.1"
FT                   /translation="MAQNKPPRFIAELEVAQGHASFSIHVSVRAASAAPEDTASTHLLP
FT                   AGDPQRAILTEAISALRQTPEGARVELRTNSDYLTDGILRWRSGWERRNFQTAKGRPVA
FT                   LADVWKTLFAEVDARQVRAVLGTSTTKSREATHHAHDAISVADHAQQMS"
     ttggcccaga acaagccgcc gcgattcatc gctgaactcg aggttgcgca ggggcacgcc        60
     tccttctcga tccacgtgtc tgtccgcgcc gcatctgccg cgccggagga cactgcgtcg       120
     acccaccttc tccccgccgg tgacccgcag agggcgatcc tgaccgaagc gatttccgcc       180
     ctccgccaga cgcccgaagg cgcgcgggtc gagctgcgga cgaacagcga ctatctgacc       240
     gacggcattc ttcgctggcg tagcggctgg gagcgccgga actttcagac cgcgaagggc       300
     aggcccgtcg ctctcgccga cgtctggaag accctgttcg ccgaagtcga cgcccggcag       360
     gtccgtgcgg tgctgggcac ctcaacgaca aagagccggg aagcgacgca ccatgctcat       420
     gacgccatct ccgtcgcgga ccatgcgcaa cagatgagct ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page