(data stored in ACNUC7421 zone)

EMBL: CP000690.PE138

CP000690.PE138       Location/Qualifiers
FT   CDS_pept        150680..151297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3438"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29042"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW0"
FT                   /protein_id="ABQ29042.1"
FT                   /translation="MNSISPSPLVRNQQLVVNLFGGPCAGKSSLAAILFGRLKREHYEA
FT                   ELAVEFAKDLAFENRRDALKCQIYVLGNQYWRIQRAFSGGAQIVVTDSPCLLSCAYQTS
FT                   PGIEAAALEAHFAYPSLNLFVDRSERYSAYGRVHERDQAEQIDERIIGILNRFSIPFTR
FT                   VSIEHGEQQAVAMVLEQARRAAETIGAEPLSSFDHDNAPLPC"
     atgaactcaa tatccccctc cccgctcgtc cgtaaccagc agctcgtcgt caacctgttc        60
     ggcggtccct gcgccggcaa gtcgagcctg gcggcgatcc tgttcgggcg tctgaagcgc       120
     gagcactacg aggcggagct cgccgtcgag ttcgccaagg acctcgcctt cgaaaaccgg       180
     cgcgacgcgc tgaaatgcca gatctacgtc ctcggcaacc agtactggcg catccagcgc       240
     gccttctccg gcggcgccca gatcgtggtg accgacagcc cctgcctgct gtcttgcgcc       300
     taccagacca gccccggcat cgaggccgcg gcactggagg cgcatttcgc gtacccctca       360
     ctgaacctct tcgtcgaccg ctcggagcga tacagcgcct atggccgcgt ccacgagcgc       420
     gaccaggccg aacagatcga cgaacgcatc atcgggatcc tgaaccggtt cagcatcccc       480
     ttcacccgcg tctcgatcga gcatggcgaa cagcaggcgg tcgcgatggt gctggagcag       540
     gcacgacggg cagcagagac aatcggggcg gagccgctaa gcagcttcga ccatgataat       600
     gcccccctcc cctgctag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page