(data stored in ACNUC7421 zone)

EMBL: CP000690.PE14

CP000690.PE14        Location/Qualifiers
FT   CDS_pept        complement(18027..18344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3306"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28918"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI6"
FT                   /protein_id="ABQ28918.1"
FT                   /translation="MTKEELTVWALANGWRLIAGHPSLTKPGAPNDPIVRLVRKATVVN
FT                   LEVRKPAGKWEKVAGESYADIVAGAEDELPRGLGFEKVPSITLLMQENRDAMVFARFSG
FT                   R"
     gtgacgaagg aagagctgac cgtctgggca ttggcgaatg gctggcggct catcgcaggc        60
     catcccagcc tgacaaagcc gggcgcgccg aacgatccca ttgtgcgtct tgtgaggaag       120
     gcgacggtag tcaatctcga agtacgcaag ccggcgggca aatgggagaa agtggctggt       180
     gagagctacg ctgatatcgt ggcaggcgcg gaagacgaac tgccgcgtgg ccttggcttc       240
     gaaaaagtcc cgagcatcac gctgctgatg caggaaaatc gcgacgccat ggtattcgca       300
     cgattcagcg gcagatag                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page