(data stored in ACNUC7421 zone)

EMBL: CP000690.PE140

CP000690.PE140       Location/Qualifiers
FT   CDS_pept        153446..154381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3440"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3440"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29044"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW2"
FT                   /protein_id="ABQ29044.1"
FT                   /translation="MINRLDQNVAQLVLDYGSERAREIVGPRYRALVDIANEVLTDERQ
FT                   QIGISYSGFCLTSLPHKRLSDSAVWQRKGHKVTLLVEPGVMRSKGRTVLYGVPFGARAR
FT                   MILLYLQTQAIRTNSREIELGRSMRTWMERMGIAIGGETTRALREQAARISACSLKFFW
FT                   EGDGAEGWTRGGIVSSGLRFKSVVDDDDQGKLWDDRVVLDETFWRALKDHPVPLQEAAI
FT                   RALAHRSLALDVYIWLAWRCHEIKGPTDISWISLDAQFNTTGRPLKYFKPLFTDALRAA
FT                   MAAYPDCRLDVEDRGITLRPSRPPVLKLMT"
     atgatcaatc gcctggacca gaacgtcgca cagctggtgc tcgattatgg cagtgagagg        60
     gcccgggaaa tcgtcggtcc ccgctaccgc gcgcttgtgg atatcgccaa cgaggtgctg       120
     acagacgagc gtcagcagat cggcatctcg tattccgggt tctgcctgac cagtctgccc       180
     cacaagcggc tttccgacag cgccgtgtgg cagcggaagg ggcacaaggt taccctgctc       240
     gtcgaacccg gggtaatgcg ctccaagggc cgcacggtcc tgtatggcgt cccgttcggg       300
     gctcgagcca ggatgatcct cctctacctc cagactcagg cgatccggac gaacagccgc       360
     gagatcgagc tcggccggtc catgagaacc tggatggagc gcatggggat cgccatcggg       420
     ggagagacga cacgagccct gagggaacag gcggcgcgga tatcggcctg cagcctcaag       480
     ttcttctggg aaggcgacgg cgccgaggga tggaccaggg gcgggatcgt ctcatccggc       540
     cttcgcttca agagcgtggt tgatgacgac gaccagggga agctgtggga cgaccgcgtc       600
     gtgctggacg agacgttctg gcgtgcgctg aaggaccatc ctgttcccct gcaggaggct       660
     gcaatccggg ctcttgccca ccgctccctg gcgcttgacg tctacatctg gcttgcctgg       720
     cgctgccacg agatcaaggg gccgacggac atatcctgga tctcactgga cgcgcaattc       780
     aacacgacag gtcggccgct gaagtacttc aagcccctgt tcacggacgc tctgcgagcg       840
     gccatggcgg cctatcccga ctgccggctg gatgtggagg atcggggcat taccctccgg       900
     ccctccaggc cgccagtgct caagctgatg acatag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page