(data stored in ACNUC7421 zone)

EMBL: CP000690.PE141

CP000690.PE141       Location/Qualifiers
FT   CDS_pept        complement(154742..155326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29045"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW3"
FT                   /protein_id="ABQ29045.1"
FT                   /translation="MRGVGFLDRHSSPSFRLLIAVGFLDRGSAPVIQAVDRLWPALRCF
FT                   GILLIFLGFSGQLGNPTPATGVSGPPPSRAIAGMWDFSTFGSHADVAGKILCWSGNPTL
FT                   GPLGSVWEAIEITNYFRLAGFMTPMVKKSHAPLVLQFRPVGNSHAMPGRVISVGKSHKF
FT                   RRRRSATRNARSGNPTFPTPARQTLQHHESI"
     atgaggggtg tgggatttct cgaccggcat tcatcgccga gtttcaggct gctgatcgct        60
     gtgggatttc tcgaccgtgg atcggcccca gtcatccagg ctgtcgaccg cctttggccg       120
     gcactccggt gctttggaat cctcctgatt tttttggggt tttccgggca gttaggaaat       180
     cccacacctg caactggggt ctctggcccg ccaccctccc gggccattgc cggtatgtgg       240
     gatttctcga ccttcggatc gcacgctgat gtcgcaggca agattctctg ctggtcagga       300
     aatcccacgc ttggcccgct cggcagcgta tgggaagcta ttgaaattac gaattatttt       360
     cggctggctg gatttatgac tccgatggtc aagaaatccc acgccccgct ggtgcttcag       420
     ttccggccag tcggaaattc ccacgccatg ccagggcggg ttatttcggt cggaaaatcc       480
     cataaattca ggaggcgacg gagcgcgact cggaatgcgc ggtcaggaaa tcccacattt       540
     cccacaccag ccagacaaac tctgcaacac catgaaagta tttga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page