(data stored in ACNUC7421 zone)

EMBL: CP000690.PE142

CP000690.PE142       Location/Qualifiers
FT   CDS_pept        complement(155465..156511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3442"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29046"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW4"
FT                   /protein_id="ABQ29046.1"
FT                   /translation="MRAARTGKESTGFFRIGEASEVGGLVLGGDYCAEHESGIEELRRE
FT                   FGISSKAPPGIERYRISGLSSRSALVFCDRPDLDQSILCCSHPSNVAQLVGKPGITGGL
FT                   ATRHEGFDLVAANRLVAFLPTWRDKDDRVRVLPVHSKAADREAWKAYNAGIIGAWSERS
FT                   FMVRALGEDARRDLEAVYNALLGCDIALSATRALTPFGRGGLAIVIASRIQPADLDRLR
FT                   EQDEDQDLLDATFKATGLPARFAERRGTDPLFGPNAKPAYFGIRPTWTREFIERRKADP
FT                   AARPTEDDLTVWLNPMEQRHHNFGWFSVDALRRWFDGEGPVVKAWVEQQRVGFPDQPAP
FT                   DGLAPGCG"
     atgcgcgcgg cacggacagg caaggaaagc acgggcttct tccggatcgg ggaggccagc        60
     gaggtgggcg gtctggtgct cggcggcgac tattgcgcag agcacgagtc cgggatcgag       120
     gagctccgcc gggagttcgg gatctccagc aaggctccgc ccggcataga gcggtaccgg       180
     atatccggac tgtcgagccg gtcggcactg gtgttttgcg accgcccgga cctcgaccag       240
     tcgatcctct gttgctcgca cccgtccaat gtcgcccagc tggtcggcaa gcccggcatc       300
     accggtggcc tcgcaacgcg gcacgaggga ttcgacctcg tggccgccaa ccgtttggtc       360
     gcctttctgc cgacctggcg ggacaaggac gacagggtgc gggtcctgcc tgtccattcg       420
     aaggccgccg accgggaagc ctggaaggcg tacaacgcgg ggatcatcgg ggcctggagc       480
     gagcggtcgt tcatggtccg ggcactcggt gaagatgccc gccgggatct cgaggcggtc       540
     tacaacgcgt tactgggctg cgacatcgcg ctcagcgcaa cgcgcgccct cacgcctttc       600
     ggccgcggtg gcctggccat cgtgattgcc tcacggatcc agccggccga ccttgaccgt       660
     ctgcgcgagc aggacgagga tcaggacctc ctcgatgcga cgttcaaggc caccggcctc       720
     cctgcccgct ttgccgagcg ccgcggcacc gatccgctgt tcggcccgaa cgccaagcct       780
     gcctatttcg ggatccggcc gacctggacc cgggaattca tcgagcgccg gaaggccgac       840
     ccagcggccc gtccgaccga ggacgacctg accgtctggc tcaacccgat ggagcagcgc       900
     caccacaact tcggttggtt ctcggtcgac gccctccggc gctggttcga cggcgaaggc       960
     ccggtcgtga aggcttgggt ggaacagcag cgtgtgggat ttcccgacca gcctgcccca      1020
     gatggcctgg cccccggctg cggctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page