(data stored in ACNUC7421 zone)

EMBL: CP000690.PE143

CP000690.PE143       Location/Qualifiers
FT   CDS_pept        complement(156542..159727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3443"
FT                   /product="Superfamily I DNA and RNA helicase and helicase
FT                   subunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3443"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29047"
FT                   /db_xref="GOA:A5FTW5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW5"
FT                   /protein_id="ABQ29047.1"
FT                   /translation="MSTTQRRRPPTQFIGATDDDVPEVAEIVAESRKAEIGTGQPIRVA
FT                   GSQHAAPAAPAGQPAQDDESVLTVLPAQPANPAEQPVELSPSQKKGLAVLDAWIAAEVL
FT                   TPETVKDLKDIVSGRERDMAALDLVYGDALPWEEGYPETEFPNLRAGYLAYDVIFGSIP
FT                   EAKAAVRLEEVYGQSFGDGGAGSGVSILATLRVAPNGTLDLKDGVSPFSVSAYGWGLVR
FT                   ALNRDLGAMPGWKHAAADISKSFRDLFDDRFKDKPIDKAAILEIYYWMLDSLGFDEKLV
FT                   SRPSRESDVVSKPAKVIGYYQRVSPDGTPVPKQRMPDALIMNSFFLSDLLDARRDLAKG
FT                   IEQPLLDRYLGVKEQVRRINILEDPKAINTLLRPGLFPEGKWPHAGRNQLVAMQQSIIN
FT                   YALHPAQVRRNKVIGVNGPPGTGKTTLLKDAAAALIVRRAIAMSDFIHPSHAFRVFGSG
FT                   GARSSGRADPSLFELDPKLIGFEMLVASSNNGAVENVSTEWPDNGAIADDATTRYYPGT
FT                   ASRLHERESWGLVSAALGNSANRAKFRDQFWFDEDWGLRNQLALAAGRSPVIVDKKTGA
FT                   KRIPASFEAHRPARGRHAALERWNRERDRFLQLLDTVRKSLSDVNKAATGELDQSDPFH
FT                   FHTSSPWLSGADHRQREDLFEAAIDLHRAFMEGAATEVGSNLSAAMELLAGRFNGRKPK
FT                   VVQSVLSTLFIAVPVLSTTFASVRRMLRDVEEPMIGWLFIDEAGQATPQSAVGAIKRSR
FT                   NALVVGDPIQVEPVVTLNEPMVVEIAKAMGIDHEVDMAPWGSVQTFADGASEVFAEYPC
FT                   EGGARRVGMPLLAHRRCAEPMFSISNQIGYGGLMVNAKRPSPSAIRDACGPSRWIDVHD
FT                   PVDEKWSEQEGMVVFNLLRDIVARGGKLDLYIISPFRIIESRLRDMVIQNHAGIGISFA
FT                   EARELTRRIGTVHKVQGREAEGVIFVLGHQGEAFKRARGWAGGRPNIANVAVTRAKEVL
FT                   YIVGNRADWSEAGYFHTVEQVMDEFTRQHGVAAGDALAVPPAPIREEQTEAPAPVLEDH
FT                   ESIFDLDLGLGLG"
     atgagcacga cccagcgcag acgcccgccg acgcaattca tcggcgcgac agacgatgat        60
     gtccccgagg ttgcggagat cgtcgcggaa agccgcaagg ccgagatcgg cactggccag       120
     cccatccgcg tggccgggtc tcagcatgcc gcgcctgccg cgcccgccgg gcaacccgcc       180
     caggacgatg agtccgtttt gaccgtcctg ccggctcaac ctgccaatcc ggcagagcaa       240
     cctgtcgagc tcagcccgtc gcagaagaag ggcctggcgg tgctcgatgc gtggatcgcc       300
     gcggaggtcc tgacgccgga gaccgtgaag gacctgaagg atatcgtctc gggccgcgag       360
     cgcgacatgg cggcgctcga tctcgtctac ggagatgcgc tgccgtggga agaaggctat       420
     ccggagacag agttcccgaa cttgcgtgct ggctacctcg cctatgatgt catcttcggg       480
     tcgatcccgg aagccaaggc agccgtcagg ctcgaggagg tctatggcca gagctttgga       540
     gatggtggcg ccgggtcggg cgtttcgatt ctcgccacgc tccgcgtggc gccgaacggc       600
     acgctcgatc tcaaggacgg agtttcgccc ttctctgtat cggcgtacgg atggggactc       660
     gtgcgcgcgc tgaaccggga tctgggcgca atgccaggct ggaagcatgc cgccgctgac       720
     atcagcaaga gtttccgcga tttgttcgac gaccggttta aggacaagcc gatcgacaag       780
     gctgccatcc tcgagatcta ctactggatg ctcgacagcc tggggttcga tgagaagctg       840
     gtctcacggc catcacgaga gtccgacgtg gtcagcaagc ccgcgaaggt gatcggttac       900
     taccagaggg taagccccga cggcacgccg gtgccgaaac agcgaatgcc cgacgccctg       960
     atcatgaaca gcttttttct cagcgacctg ctcgacgccc gccgcgatct ggcgaagggt      1020
     atcgagcagc ctctcctcga tcggtatctc ggcgtgaagg aacaggtccg taggatcaac      1080
     attctcgagg acccaaaggc catcaacacg ctgctgcgcc ccgggctttt cccggagggg      1140
     aagtggccgc acgcgggccg caatcagctg gtcgccatgc agcagtcgat catcaattat      1200
     gcgctgcacc ccgcgcaggt ccgccggaac aaggtgatcg gtgtcaacgg cccaccgggc      1260
     accggaaaga ccacgttgct gaaggacgcg gccgcggcgc tgattgtccg tcgcgctatc      1320
     gcgatgagcg atttcatcca cccctcccac gcctttcgcg tattcggatc tggaggagcg      1380
     cgttcctccg ggcgcgccga cccatccttg ttcgagctcg atcccaagct gatcggcttc      1440
     gagatgctgg ttgcctcctc gaacaacggc gcagtcgaga acgtctcgac cgaatggccg      1500
     gacaatggcg cgatcgctga tgatgcgaca accagatact acccgggaac agcatccagg      1560
     ctgcatgagc gcgagagctg ggggctggtc tcggccgcgc tcggcaattc ggcaaaccgg      1620
     gcgaaatttc gtgaccaatt ctggtttgat gaagactggg gtctcaggaa ccagctcgct      1680
     ctggcagccg gccgctcgcc ggtcatcgtg gacaagaaga ctggagcgaa acggatcccc      1740
     gcctcctttg aggcacaccg gcccgcgcgt ggccggcatg cggcgctgga gcgctggaac      1800
     cgggagcgag atcgcttcct gcagctgctc gacacggtca ggaaaagcct gtctgacgta      1860
     aacaaggcgg cgaccggtga actcgaccag agtgaccctt ttcacttcca tacctcttcg      1920
     ccgtggcttt ccggtgcgga ccacagacag cgcgaggatc tgttcgaggc ggcaatcgat      1980
     cttcaccgcg cctttatgga gggtgcggcc acggaagtcg gctccaacct ctcggcggcg      2040
     atggaactcc tcgccggtcg gtttaacggg cggaagccga aagtcgtcca gtctgtcctc      2100
     agtacgctct tcatcgcggt tccggtcttg tcgaccacct tcgccagcgt ccgcaggatg      2160
     ctgcgcgacg ttgaagagcc gatgatcggc tggttgttca tcgacgaggc cggacaggcg      2220
     acgccgcaat cggcggtcgg cgcgatcaag cgcagccgga acgcgctcgt tgtgggcgac      2280
     ccgatccagg tcgagcccgt cgtcacgctg aacgaaccca tggtcgtcga gatcgcaaag      2340
     gcgatgggca tcgaccatga ggtcgatatg gcgccctggg ggtccgtgca gaccttcgcg      2400
     gacggggcat ccgaagtgtt cgccgaatac ccctgcgagg gcggcgcgcg ccgggtcggc      2460
     atgccgctgc tggcccatcg acggtgcgcc gagccgatgt tctcgatctc gaaccagatc      2520
     ggctacggcg gcctgatggt gaacgccaag cggccttcgc cctccgcgat ccgggatgcc      2580
     tgcgggccgt cgcgctggat cgatgtccac gaccccgtgg acgagaaatg gtccgagcag      2640
     gaagggatgg tcgtcttcaa cctcctccgc gatatcgtcg cccgcggtgg caagctcgac      2700
     ctctacatca tcagcccctt tcggatcatc gagagccggc tgcgcgacat ggtcattcag      2760
     aaccatgccg ggatcggcat ctccttcgcc gaggcccgcg agctgacccg acggatcggc      2820
     accgtgcaca aggtccaggg ccgcgaggcg gaaggtgtca tcttcgtgct gggccaccag      2880
     ggcgaggcat tcaagcgggc acgcggctgg gcgggcgggc gcccgaacat cgcgaacgtc      2940
     gccgtcacgc gggccaagga agtcctctac atcgtcggca accgcgccga ctggagcgag      3000
     gccgggtact tccacaccgt cgaacaggtg atggacgagt tcacccgtca gcacggcgtc      3060
     gccgccggcg acgccctcgc ggtgccgcct gcgcccatcc gagaggagca aacggaagcg      3120
     ccggcgccgg ttctcgagga tcacgagtcc atcttcgatc tcgatctcgg cctcggcctg      3180
     ggctga                                                                 3186
//

If you have problems or comments...

PBIL Back to PBIL home page