(data stored in ACNUC7421 zone)

EMBL: CP000690.PE144

CP000690.PE144       Location/Qualifiers
FT   CDS_pept        159926..160303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3444"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29048"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW6"
FT                   /protein_id="ABQ29048.1"
FT                   /translation="MSSNSDQKIDFSATFGLSKSVPAMIEARDHLGRHFPTRPWEDILL
FT                   GAVQPPAPIEVVHYSTGAVAIFWTRGASIVCLLYQGDGCVFHGQGSDGRDCARLGTMSY
FT                   VEEVLPRSVMLEILAVCRQKG"
     atgagcagta attctgacca gaaaatcgat ttctccgcga cattcggact ctcgaagagt        60
     gtgcccgcga tgatcgaggc gcgagatcat ctcggccggc attttccgac gcggccttgg       120
     gaggacatcc tgcttggtgc ggtccagccg ccggcaccga tcgaggtcgt gcactacagc       180
     actggagcgg tcgcgatctt ctggacgcgt ggcgcgtcga tcgtctgcct gctctaccag       240
     ggggacggat gcgtcttcca tggccagggt tcggacggcc gggactgcgc ccggcttggg       300
     acgatgagct atgtcgagga ggtgttgcct cgctctgtga tgctcgagat cctggcggtg       360
     tgccggcaga aggggtga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page