(data stored in ACNUC7421 zone)

EMBL: CP000690.PE145

CP000690.PE145       Location/Qualifiers
FT   CDS_pept        160447..161007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29049"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW7"
FT                   /protein_id="ABQ29049.1"
FT                   /translation="MNSRTIITSSALIMMLAAGSALAQTSAGGQAGVGASVGVGANAGA
FT                   GGLVGSTLGAARSTAGNVGSAVGSTAAGVTSKVGAQANGMARSAEATSADFSAATISKA
FT                   RLATRQISVLEAREHREIRTAKTASRRRAIETRARAERARLIKSHGLSVSEYDRIVSEA
FT                   RSNPSLASRIGLSVSAGAGAQMK"
     atgaactctc gcaccatcat cacgtcgtcg gcgctcatca tgatgctggc cgctggtagt        60
     gctctcgccc agacatctgc cggaggccag gccggtgtcg gcgcctctgt gggtgtcgga       120
     gcaaacgccg gtgctggcgg gctggtcggc agcacgctgg gtgccgcaag gtcgacggcc       180
     gggaatgtcg gcagtgcggt cggctcaacc gccgcgggcg tgacgagcaa ggtgggcgca       240
     caggcgaatg gcatggcaag atctgccgaa gcaacgtccg ccgatttctc ggcggccact       300
     atatccaagg cgagattggc aaccaggcag atctctgttc tcgaggcacg tgagcaccgt       360
     gagatccgga cagcgaagac ggccagccgt cgtcgggcca tcgaaaccag ggcccgggcc       420
     gaacgcgcgc ggctgatcaa gagccacgga ctgtcggtgt ccgaatacga tcggatcgtg       480
     agcgaggccc ggagcaaccc aagcctcgcc agtcgcatcg ggctgagcgt atctgcaggt       540
     gccggcgcgc agatgaagtg a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page