(data stored in ACNUC7421 zone)

EMBL: CP000690.PE146

CP000690.PE146       Location/Qualifiers
FT   CDS_pept        complement(161163..163016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3446"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29050"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW8"
FT                   /protein_id="ABQ29050.1"
FT                   /translation="MAIHLVGETIDAKRAHHRAQSGDLIPLVRGVYVDHDGDAETAILA
FT                   HAVRIAHYLYPNAYLSSASAVLLAPTPDGRLFISGRRNQRTRLRALEIIQNEAPAHPST
FT                   AIAVIGDDLGELRIAASSPRQRFLEAFRLRSEHASAITAEMRAQMAARLVAEHGTPQAA
FT                   ADAVWALARENEWYREGEGAERFLLAKPGGAAPVNKAALNLLVAWHGDLVGRLTHDGFE
FT                   WRWKPERRTGPALIRGTTPGKLPAFIESLLPEGWLAQVLHERDERDALRRGRRYMSNIA
FT                   IVEDRDQLATLPADVLSTPLSSFAADGRFTGVYAGPGRGEIEDTFEQNLARIFARSETP
FT                   RLSGVQIKAPMSLTKDGSLVPAIDQPFTHILKPTGAAGFDMLPIVEWLCLELGRAAGFE
FT                   TPDAALIAMPDGMPPSLVVERFDIRRGPHDLRRLAMEDFCSVLDLPTSAKYDGTIERMA
FT                   RALRPLSTDPAADLNILFRRAVFAWLIADGDMHLKNLAVLKTADVGAKTFTTVRFAPLY
FT                   DAVTTRVFPSLAGDRMALKLNGKDDRLTRQDFLRLARTIGLTVEDAEAALEALTTRITE
FT                   RLVTLQLPAFAVEFADAKAVRDKVEAIATARCLALRRRGQP"
     atggcaatcc acttggtcgg agagacgata gacgccaaac gggcgcatca tcgcgcccaa        60
     agcggtgact tgatccccct cgttcgtggt gtctacgtgg atcacgacgg cgatgccgag       120
     acggctatcc tagcccacgc cgtgcggatc gcgcattacc tctatccaaa cgcctaccta       180
     tcatccgcca gcgctgtcct gctcgcgccc acgccggatg ggcgcctctt catcagtggt       240
     cgacgcaacc agcgaaccag gttgcgggcc ctggaaatca ttcaaaatga ggctccggcc       300
     cacccctcga cggcgatcgc cgtcattggc gatgatctcg gagagctgcg catcgccgct       360
     tcgtcgccac gacagcgctt cctcgaagcc tttcggttga ggagcgagca cgccagcgcc       420
     atcaccgccg agatgcgcgc ccagatggcc gcccggttgg tggcggaaca cggcacgccc       480
     caggcggcgg ctgacgccgt ttgggcgctt gcccgcgaga acgaatggta tcgggagggt       540
     gagggcgcag aacgcttcct cctcgccaaa cccggaggcg cggcgcccgt gaacaaggcc       600
     gcgctcaatc ttttggttgc ctggcacggg gatcttgtcg gtcgtttgac ccatgacggc       660
     ttcgagtggc gctggaaacc tgagcggcgc actggtccgg cgctcatccg cgggacgacg       720
     cccggcaaat tgccggcctt catcgaatcg ctgctgcccg agggctggct cgcccaggtc       780
     ctgcatgaac gcgacgagcg cgatgccctg cgccgaggtc gacgctacat gtcgaacatc       840
     gccatcgtcg aagaccggga tcagttggcg acgctgccgg ctgatgtgct gtcgacccca       900
     ctctccagct ttgccgctga cggtcgcttc acgggggtct atgccggccc cggacgcggc       960
     gaaatcgaag acaccttcga gcagaatctg gcgcgcatct ttgcgcgctc tgaaacgccg      1020
     cgcttgtcgg gcgtccagat caaggcgccg atgagcctga ccaaggacgg gtcccttgtc      1080
     ccggcgatcg atcagccctt cacccacatc ctgaagccaa caggcgcggc gggcttcgac      1140
     atgctaccga tcgtcgagtg gctgtgcctc gaacttgggc gcgccgcagg gttcgagacg      1200
     ccagacgccg cgttgattgc gatgccggac ggcatgccgc cgtccttggt cgtcgaacgg      1260
     ttcgacatca gacgtggacc acacgatctg cgtcggctcg cgatggagga tttttgctcc      1320
     gtcctcgatc tcccgacatc ggcgaaatac gacggaacga tcgagagaat ggcgcgcgcc      1380
     ttgcgtccgc tttccaccga cccggccgca gacctcaaca tcctgttccg acgcgcggtg      1440
     tttgcctggt tgatcgccga cggcgatatg cacctgaaga atctcgccgt cctaaagacg      1500
     gctgatgtgg gcgcgaagac gttcacgacc gtccgttttg cgccactcta cgatgccgtg      1560
     accacacggg ttttcccaag ccttgccggc gatcgaatgg ccctgaaact gaatgggaag      1620
     gatgatcggc tgacgcgcca ggattttcta cgcctcgcgc gcacaatcgg tctgaccgtc      1680
     gaggatgcgg aagccgcgct cgaagccctc acaacacgga tcacagagcg cctggtgacc      1740
     cttcagctcc ccgcattcgc cgtcgaattc gccgacgcta aagcagttcg cgataaggtt      1800
     gaggccatcg ccacagcgcg gtgtctggcg cttaggaggc gtggacaacc ctga            1854
//

If you have problems or comments...

PBIL Back to PBIL home page