(data stored in ACNUC7421 zone)

EMBL: CP000690.PE147

CP000690.PE147       Location/Qualifiers
FT   CDS_pept        complement(163196..164137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3447"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29051"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTW9"
FT                   /protein_id="ABQ29051.1"
FT                   /translation="MARIRFRSAALPAAVILLGLTGCANLQGAPGKAASAKPVPPDMVG
FT                   IHINDGDSMFPVQTGDAARQAIPSLKAMSRMHRDGSGTSKEAAKEMVELPVIRDTALRY
FT                   GAEGGVAWATRIIDGELRANAARLSQIYDFSRLVTYQPGGVQILPPVISESRNLYQSSD
FT                   FGRTIRVADTYYDIVRQARFVPSAPLWYGYLYRTWQAPHRPFEAGLPHNSEEEAVWKHY
FT                   VKAGWRAGVQEGETIFRLDLDRLNRDFTGMIRYRKLNDEGKVSAPVVQAKTLGVTGTGQ
FT                   NMREGDRVVKIIAEPSLSVPHPRTSPIKATPN"
     atggcgcgca tccgtttccg atcggccgcc ctccccgccg cggtcatcct ccttgggctg        60
     accggctgcg cgaacctgca gggtgcgccc ggcaaggccg cgtcggcgaa gcccgtcccg       120
     ccggacatgg ttggcatcca tatcaatgac ggtgattcga tgttcccggt ccagaccggc       180
     gacgccgccc ggcaggcaat tccgagcctc aaggcgatga gccgcatgca ccgcgatggc       240
     tcggggacaa gcaaggaagc cgcgaaagag atggtcgagc ttccggtcat ccgcgacacc       300
     gcgctgcgtt acggcgccga gggcggcgtg gcctgggcga cccggatcat cgacggcgag       360
     cttcgcgcga acgccgcgcg tctcagccag atttacgact tctcgcggct ggtcacctat       420
     cagccgggcg gcgtgcagat cctgccgccg gtgatttccg agagccggaa cctgtaccag       480
     tcctccgatt tcggccggac gatccgggtg gccgacacct attacgacat cgtccgccag       540
     gcacgctttg ttccgtcggc cccgctctgg tacggctatc tctaccgcac ctggcaggcg       600
     ccgcaccgcc ccttcgaggc cggactgccc cacaactcgg aagaggaggc ggtctggaag       660
     cactacgtga aggctggctg gcgggcgggc gtgcaggagg gcgagacgat attccgcctc       720
     gacctcgacc ggctgaaccg cgacttcacc ggcatgatcc gctaccgcaa gctcaacgac       780
     gaaggaaagg tctcggctcc ggtcgtccag gccaagacgc tcggcgtcac cggcaccggt       840
     cagaacatgc gcgaaggcga ccgggtggtg aagatcatcg ccgagcccag cctgagcgtg       900
     ccgcatccgc ggacatcccc gatcaaggcg acgccgaact ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page