(data stored in ACNUC7421 zone)

EMBL: CP000690.PE148

CP000690.PE148       Location/Qualifiers
FT   CDS_pept        complement(164140..164691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3448"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29052"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="InterPro:IPR038140"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX0"
FT                   /protein_id="ABQ29052.1"
FT                   /translation="MVRIRSKAVLAVLALVAGMPALAHADVMTTEAQAVQAEAESNLAR
FT                   AFTEASQALSQLDNGPVDPQQVATPKGVAIAAPAAPVQAALPKIDLARLPAQLRRPVTI
FT                   RWNGPVEGAIRKLAAQINYTVLPPTHTPATPPTIVLVKNKVPAAIVLQDIGARIRTYGK
FT                   LVVSPAARTIQFDVNQAAGT"
     gtggtacgca ttcgctccaa ggccgttctc gccgtgctcg cgctggttgc cggcatgccg        60
     gcactcgccc acgcagacgt catgaccacc gaggcccagg ccgtccaggc cgaggctgaa       120
     agcaatctcg cccgggcgtt caccgaggcg agtcaggcac tctcccagct cgacaatggt       180
     ccggtcgacc cgcagcaggt ggccaccccc aagggtgtcg ccatcgccgc ccccgcggcg       240
     ccggtccagg cggccctgcc gaagatcgat ctggcccgcc tccccgccca gcttcgccgc       300
     ccggtgacga tccgctggaa cgggccggtc gagggcgcca tccggaagct cgcggcccag       360
     atcaactaca cggtcctccc gccgacccac acgcccgcga ccccgccgac gatcgtcctg       420
     gtcaagaaca aggtgccggc ggcgatcgtg ctgcaggaca tcggcgcgcg gatccgcacc       480
     tacggcaagc tagtggtttc gccggcggcc cgcaccatcc agttcgacgt caaccaggcg       540
     gccgggacct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page