(data stored in ACNUC7421 zone)

EMBL: CP000690.PE149

CP000690.PE149       Location/Qualifiers
FT   CDS_pept        complement(165544..166482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3449"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29053"
FT                   /db_xref="GOA:A5FTX1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX1"
FT                   /protein_id="ABQ29053.1"
FT                   /translation="MPDDALDAPDDEHIDPLDFVRWLIGLRPTLSSSTWRSYKAASAFY
FT                   LYDSMHPSARAAAAILDGVSADDGEVAASEGVKGTKFFRLEDYNKLLQFCLDRGRGESA
FT                   RTMFHFARAAIRTGMRPSEWATCDMRTSKNPDAPFGRNVWLFVCNAKASNGRANGLVRV
FT                   LDLSPLSRIDIEPIRYTMALFQRQAAKEGTEPTIRRLRQSINHIGAATGMSAKYSPYSF
FT                   RHQAIANWKTIYSPVEVAALAGHSVPETATEHYGRKRDGWTGKGTGGIMIRPSRVDVER
FT                   IMSRIRSDNPAPFMRPDGSLAVVPEDMPTPQ"
     atgcctgacg acgcgcttga tgcacccgat gacgagcata tcgacccgct cgactttgtg        60
     cggtggctca tcggcctgag accgaccctc agttcctcga catggcgttc atacaaggct       120
     gcgagcgcat tctatctgta tgactctatg cacccttcgg cgcgggcagc agctgcaatc       180
     cttgacggcg tgagcgccga tgacggagag gtggcagcgt ccgagggcgt caaggggacg       240
     aagttcttcc ggctcgagga ctacaacaag ctcctgcagt tctgcctcga tcgggggcgt       300
     ggagaatctg ctcgcaccat gttccacttc gcgcgcgccg cgatccgaac cggcatgcgg       360
     ccctcggagt gggcaacctg cgatatgagg acttcgaaga acccagacgc gccgttcggc       420
     cgcaatgtct ggctcttcgt ctgcaacgcg aaggcgtcga acgggcgggc caacgggctg       480
     gtgcgggttc tcgacctgtc tccgctatcc cggatcgata tcgagcccat ccggtacacg       540
     atggcactct tccagcgtca ggcggccaag gaggggacgg aaccgaccat caggcggctg       600
     cgccagtcga tcaaccatat cggggcagcc acagggatgt cggcgaaata ctccccctac       660
     tccttccgcc accaggcgat cgccaactgg aagacgatct acagccccgt cgaggttgcg       720
     gcgctggccg ggcattcagt gcctgagacg gcgaccgagc attatggccg gaagcgggat       780
     gggtggaccg gcaaggggac cggcggaatc atgatccgac cgtcgagggt cgatgtggaa       840
     cggatcatga gccgtatccg gtcggacaat ccggcaccct tcatgcgacc ggacgggagc       900
     ttggcagtgg tgccggagga tatgcccacc cctcagtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page