(data stored in ACNUC7421 zone)

EMBL: CP000690.PE15

CP000690.PE15        Location/Qualifiers
FT   CDS_pept        complement(19016..20407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3307"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3307"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28919"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI7"
FT                   /protein_id="ABQ28919.1"
FT                   /translation="MENFRPESGPGPKLRGVRGARRLTLGMVATERLADDFGTLSEGGQ
FT                   VDPGRVLAAFKAAAPYLRFGPRVTQAIDWLFRFTQVQDWQEGARPIVWPSAAMQMEALC
FT                   LSEAQVKRLNRLLAHLGLITMRDSPNGKRYGRRDPRGRIVEAYGFDLSPIAVRQAEFRE
FT                   IAERGRARFEALKQLRRRATIAVRGIQQIVETAAELGIAEGWVRQADEARRLVARIRRI
FT                   EELDEVTLGVTTLENRQADLRGRLEAAMGALKEAGQAPVESTNMSPKGLTDEPHITHTN
FT                   QTLDPTDHVSASRKRNSTSGGAGTSAGGSTRTGRNGDGKEAGHRPTGSRATKPEIPPDG
FT                   TVFRMTPDELVRLAPRLRAYLAKSSPGWPEIVEAADWLRHDLGVSKPLWGDACLAMGRE
FT                   QAAVALAIVSTKPSDHFRGSPGGYFHGMVARARAGELNLARSIWGIRAASGMPRPASAS
FT                   GVGAV"
     atggagaatt tccgccccga atcggggccg ggtcccaaac tacgaggcgt gcgcggcgcg        60
     cggcgcctca cgctcgggat ggttgcgaca gagcgactcg ccgatgattt cggtacgctg       120
     agcgagggtg gccaggtcga ccccggccgg gtgctggccg ccttcaaggc ggcagccccg       180
     tatctgcggt ttggcccgcg ggtcacgcag gcgatcgact ggctgttccg cttcacccag       240
     gtgcaggact ggcaggaggg cgcacggccg attgtctggc cgtcggcggc gatgcagatg       300
     gaggcgctgt gcctgagcga ggcgcaggtg aagcggctga accggctgct cgctcatctc       360
     gggctgatca ccatgcgcga cagtccgaac ggcaagcgct acggccgccg ggatccgcgc       420
     ggccggatcg tcgaggcgta tggcttcgat ctctcgccca ttgcggtccg ccaggccgag       480
     ttccgggaga tcgccgagcg tggccgggcc cgcttcgagg cgctgaagca gctgcgtcgt       540
     cgggcgacga tcgccgtgcg cgggatccag cagatcgtgg agacggcggc agagctcggg       600
     atcgccgaag gatgggtccg ccaggcggat gaggcgaggc gcctggtcgc gcggatccgc       660
     cgtatcgagg agctggacga ggtgacgctc ggcgtgacga cgctggaaaa ccggcaggcg       720
     gaccttcgcg gcaggctcga ggcggcgatg ggcgcgctga aagaggccgg ccaggctcct       780
     gtcgaatcaa caaatatgag ccccaagggg ctcacggatg agcctcatat tacacataca       840
     aaccagactc ttgatcctac ggatcacgta tctgcatcga gaaaacgtaa ctcgacctcg       900
     ggtggcgcgg gcacgagcgc tggaggctcg acgagaaccg gcaggaatgg ggatgggaag       960
     gaagccgggc atcggccgac cggcagtcgg gcaacaaagc ctgaaatccc gccggacggc      1020
     acggtgttcc gcatgacgcc ggacgagctg gtcaggctgg cgccccgatt gcgggcttac      1080
     ctggcgaaat cctcgcccgg atggccggaa atcgtggagg cggccgactg gctgcgtcat      1140
     gacctcggcg tctcgaagcc gctatggggg gatgcgtgcc tggcgatggg gcgcgagcag      1200
     gcggccgtgg cactggccat cgtctcgacc aagccgagcg accacttccg cggctcgccg      1260
     ggcggttatt tccacgggat ggtggcccgg gcgcgtgccg gcgagctgaa cctggcgcgg      1320
     tcgatctggg ggatccgggc ggcgagcggg atgccgcggc cggcgtcggc gagtggcgtg      1380
     ggggctgtct ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page