(data stored in ACNUC7421 zone)

EMBL: CP000690.PE150

CP000690.PE150       Location/Qualifiers
FT   CDS_pept        167207..167761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3450"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29054"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX2"
FT                   /protein_id="ABQ29054.1"
FT                   /translation="MTATAAIPVDRPSYHEGKRLYRRLVAGDLSHLAPVLASLQPLVGA
FT                   AAAGLAARLIEAGVDADELLVRAALAHHVRRPGYLERMAAPDSMRHDLDGNPVEPVSAR
FT                   HRDHAAATRKAMGPSLAKARQQARRRTEREARSRWRATPAPVVEVKQAGRRRLAAPAGA
FT                   GQGAVASLRDRLGIAARLSLG"
     gtgaccgcca cagccgccat ccccgtcgac cggccgtcat accacgaagg caagcggctt        60
     taccgccgcc tggtcgccgg cgacctgtcg cacctggcgc ccgtcctcgc atccctgcaa       120
     cccctcgtcg gcgccgccgc ggcgggcctg gccgcccggc tcatcgaggc cggggtcgat       180
     gcggatgagc tcctggtccg ggcggcactt gcccatcacg tccgccggcc cggctacctg       240
     gagcggatgg ccgcgccgga cagtatgcgc cacgacctgg atggcaatcc ggtcgagccg       300
     gtgtcagcgc gccaccgcga ccatgcggct gcgacccgga aggcaatggg ccccagtctg       360
     gcgaaggcca ggcagcaggc gcggcgccgc acggagcggg aggcccgctc gagatggcgt       420
     gcaaccccgg ctccggtcgt cgaggtgaag caggccggcc ggcgtcggct ggcggctccg       480
     gccggggcgg ggcagggggc tgtggcgagc cttcgtgatc ggctgggcat tgccgcgcgc       540
     ctgtcgttgg gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page