(data stored in ACNUC7421 zone)

EMBL: CP000690.PE151

CP000690.PE151       Location/Qualifiers
FT   CDS_pept        complement(167766..168089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3451"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29055"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX3"
FT                   /protein_id="ABQ29055.1"
FT                   /translation="MAAESAALTPAEASASLAALSQQLAGKFVVSQPSERTARKAVDTL
FT                   QSAAPGSFWIAFSRQELKLLWLAITNGAPEYGNALGMTPREVEMFGRAANRIGRAAGEE
FT                   VLF"
     atggccgccg aatcagccgc actgaccccc gccgaagctt ccgcgtcgct cgccgcatta        60
     tcgcagcagc ttgccggcaa gttcgtggtg tcccagccgt ccgagaggac tgcccgcaag       120
     gccgtcgaca cgttgcaatc cgccgcgcct ggctcgttct ggatcgcatt cagccggcag       180
     gagctgaagc tgctctggct cgcgatcacg aacggcgcac cggaatacgg gaacgcactc       240
     gggatgacgc cgcgggaggt ggagatgttc ggacgagcgg cgaaccggat cgggcgggcg       300
     gccggtgaag aggttctatt ctag                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page