(data stored in ACNUC7421 zone)

EMBL: CP000690.PE152

CP000690.PE152       Location/Qualifiers
FT   CDS_pept        168288..168647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3452"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3452"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29056"
FT                   /db_xref="GOA:A5FTX4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX4"
FT                   /protein_id="ABQ29056.1"
FT                   /translation="MIAPTRPADLIWRSTTMPKLSPLSREEMMRLRTQLADDVEAGGLP
FT                   LSLAVRRMRKAIGFTQVQFAKAMRLTTRQIWEIENGKANPSLETMNKLAHPFGFRVGFI
FT                   SRHRAAAMEEADRAP"
     atgatcgcgc ccacccggcc ggccgatctg atctggaggt ccacgactat gccaaagctc        60
     agccccctgt cgcgcgagga aatgatgaga ctgcggaccc agttggccga cgacgtcgag       120
     gccggcggcc tgcccctatc gctggccgtc cgacggatgc gcaaggcgat cggcttcacg       180
     caggtgcaat tcgccaaagc catgcggctc acgacccgcc agatctggga gatcgaaaac       240
     ggcaaggcga atccgtcgct cgagacgatg aacaagctcg cccacccgtt cgggttccgg       300
     gtcggcttca tctcccggca tcgagccgcc gcgatggaag aggcggatcg agcgccctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page