(data stored in ACNUC7421 zone)

EMBL: CP000690.PE153

CP000690.PE153       Location/Qualifiers
FT   CDS_pept        complement(168714..169349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3453"
FT                   /product="Uncharacterized protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3453"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX5"
FT                   /protein_id="ABQ29057.1"
FT                   /translation="MLAAKVGRIIVAAGTNGAGKSSIVGPLIRSLGGAYYNPDEQARSF
FT                   MAIGLGTEQANARAWGLGYEGLQRAIDQNLNFAFETTLGGASITMELLRALALERRVLI
FT                   FYVGLASVDLHIQRVAERVARGGHDIPERKIRERYDNSRTNLLKFIGTRAEMRVWDNSH
FT                   QSADGSPAPREVFRVQNREMLIPKGGELSATVAWAQPLVAKALSISPG"
     gtgttggccg ctaaggtcgg ccggatcatc gtcgcggcag ggaccaacgg cgccggcaag        60
     agctcaatcg ttggtccgct gatccggagc cttggcggcg catactataa tcccgacgaa       120
     caggcgcgga gtttcatggc gatcgggctt ggtaccgagc aggcaaacgc gcgagcatgg       180
     gggctcggtt acgaggggct tcagcgagcg atcgaccaga atctcaactt cgccttcgag       240
     acaacgcttg gcggtgcaag catcacgatg gagctgctgc gtgctctcgc gctcgagcgt       300
     cgggtcctga tcttctatgt cggccttgcc tcggtggatc tccacatcca gcgcgtggct       360
     gagcgggtgg cccggggtgg gcacgacatc ccggagcgga agatccgcga gcgatacgac       420
     aacagcagga ccaatctcct caaattcatc gggacgcggg ctgaaatgcg ggtctgggac       480
     aactctcacc agtcagcgga cggatcgccg gcgccacggg aggttttccg cgtgcaaaac       540
     cgggagatgc tgattccgaa gggcggcgag ttgtcggcga ccgtcgcgtg ggctcagccg       600
     ctcgtggcca aggcgctaag tatcagcccg ggctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page