(data stored in ACNUC7421 zone)

EMBL: CP000690.PE154

CP000690.PE154       Location/Qualifiers
FT   CDS_pept        complement(169336..169698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3454"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3454"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29058"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX6"
FT                   /protein_id="ABQ29058.1"
FT                   /translation="MSKSAVIEASAARSSFAKLGEQARRAPVEVTRHGKLEFVVISPDL
FT                   YEAVKAAGTVPVGELARMQESFNQMFQDMQSDRSEAAYERLEALTAEDLPKAAVDAYRR
FT                   TRRRAPGHRSGSGVGR"
     atgagcaagt cagccgtcat cgaggccagt gccgctcgga gcagcttcgc aaagctcggg        60
     gaacaggcca ggcgggcacc tgtcgaagtg acccgacacg gtaagctcga attcgtggtc       120
     atctcgccgg acctctacga ggcggtcaag gcggcgggca cggttccggt cggcgagttg       180
     gctcgcatgc aggaatcctt caaccagatg ttccaggata tgcagtcgga tcgatccgaa       240
     gcggcgtatg agaggctgga ggcactgact gcggaggacc tgccaaaggc agcggtggac       300
     gcctatcggc ggacgcgcag aagggcgccc ggtcaccggt cgggttcggg tgttggccgc       360
     taa                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page