(data stored in ACNUC7421 zone)

EMBL: CP000690.PE155

CP000690.PE155       Location/Qualifiers
FT   CDS_pept        complement(170187..170666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3455"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3455"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29059"
FT                   /db_xref="GOA:A5FTX7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX7"
FT                   /protein_id="ABQ29059.1"
FT                   /translation="MTFTESVKRGSVGWSRYSGRASRSEFWWFFLFATLVRGAFAFIRL
FT                   VLMPPPIGQGVPMLVLVTLVSLILLVPTIPLEVRRLHDVGRSGWLIVVFYVLFAALIMV
FT                   SEEWMRLLSRHQETHWQGEILLVLTVFTGVTWVRVISLLASRGGPRPNRYGPASE"
     atgaccttca ctgaatccgt gaagcggggt tcggtgggat ggtcccggta ttccggccgg        60
     gcgtcccgat ccgaattctg gtggttcttc ttgttcgcca cgcttgtgcg aggcgcgttc       120
     gcattcatca ggctggtctt gatgcccccg ccgatagggc aaggggtgcc gatgcttgtg       180
     ctggtgacac tggtctccct gatattgctg gtgccgacga tcccgctgga ggtgcggcgc       240
     ctgcacgatg tcggccgatc aggctggctg atcgtggtgt tctatgtgct gttcgccgcc       300
     ctgatcatgg tgagcgagga atggatgcgt ctgctgtccc gacaccagga aacccattgg       360
     cagggcgaga ttttgttggt cctgaccgtc tttaccgggg tgacctgggt gagggtgatc       420
     agccttctgg cgtcgcgagg cggcccgcgg ccaaacagat atggtccggc ttccgagtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page