(data stored in ACNUC7421 zone)

EMBL: CP000690.PE156

CP000690.PE156       Location/Qualifiers
FT   CDS_pept        complement(170868..171578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3456"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29060"
FT                   /db_xref="GOA:A5FTX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX8"
FT                   /protein_id="ABQ29060.1"
FT                   /translation="MSAVLEAEGLQTYYGKSHILHGVSLKVNQGELIALLGRNGAGKTT
FT                   TMRSVMGLTPPRDGNVKLFGKDVTKAASHRIANAGVGYVPEGRKIFGHMTVHENLLVPP
FT                   ETKGPWTIETIYKLFPRLEERKTSKGGRLSGGEQEMLAIARALLLNPKFLILDEPSQGL
FT                   APVIVQEVMRTIGRMKGEGMSILLVEQNAHLALQLADRAYVLSDGEVVYDGSAAELGAD
FT                   TERMEHLAGVSHVD"
     atgagtgccg ttctcgaagc cgagggcctg cagacctatt acggcaagag ccatatcctg        60
     cacggcgtct cgctgaaggt gaaccagggc gagctgatcg ccctgctcgg ccgcaacggc       120
     gccggcaaga ccaccacgat gcgcagcgtc atgggcctca ccccgccccg cgatggcaac       180
     gtcaagctgt tcggcaagga tgtgaccaag gccgcctccc atcgcatcgc caatgccggc       240
     gtcggctatg ttcccgaggg ccgcaagatc ttcgggcaca tgacggtgca cgagaacctg       300
     ctcgttcccc ccgagaccaa ggggccctgg accatcgaga cgatctacaa gctgtttccg       360
     cggcttgagg agcgcaagac gagcaagggc gggcgactct ccggcggcga gcaggaaatg       420
     ctggccatcg cccgcgcgct gctgctcaac cccaagttcc tgatcctcga cgaaccctcc       480
     caggggcttg ccccggttat cgtgcaggaa gtgatgcgca cgatcggccg gatgaaaggc       540
     gaggggatgt cgatcctgct ggtcgagcag aacgcgcatc tcgccctcca gctcgccgac       600
     cgcgcctatg tgctgtccga cggcgaggtc gtctatgacg gctccgccgc cgaactcggt       660
     gcggatacgg aacggatgga acacctcgcc ggcgtcagcc acgtcgacta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page