(data stored in ACNUC7421 zone)

EMBL: CP000690.PE157

CP000690.PE157       Location/Qualifiers
FT   CDS_pept        complement(171575..172339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3457"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3457"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29061"
FT                   /db_xref="GOA:A5FTX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTX9"
FT                   /protein_id="ABQ29061.1"
FT                   /translation="MSLLKLEHVGRRFGALQALKDISLAVEPGELRAIIGPNGAGKTTL
FT                   FNLISGFFPPTEGQIIFDGQPITAVSPNDLVRRGIIRTFQITQVFLSLSVYENIRVAVE
FT                   TAMGLQLRPWISRAARAKVDEKVDELLQVTRIANKADRIVGEMSHGDQRVVEIGIALSR
FT                   HPRLLLLDEPTAGMGDEETHHMTDLIRRLNKDQGITMLFVEHDMAIVFGIADRITVLDN
FT                   GTFLAEGTAAEISANPRVQSAYLGTAIEETAA"
     gtgagccttc tgaaactcga acatgtcggc cgccgcttcg gcgcgctgca ggcgctgaag        60
     gacatttcgc tcgcggtcga gccgggcgag ctgcgcgcca tcatcgggcc gaacggcgcg       120
     ggcaaaacca cgctgttcaa cctgatcagc ggtttcttcc cgcccaccga gggccagatc       180
     atcttcgacg gccagccgat caccgcggtc agcccgaacg atctggtccg ccgcggcatc       240
     atccgcacct tccagatcac ccaggtcttc ctctcgctct cggtctacga aaacatccgc       300
     gtcgcggtgg aaacggcgat gggcctgcag ctccgcccct ggatctcgcg ggcggcgcgc       360
     gcgaaggtcg atgaaaaggt ggacgagctg ctccaggtca cccgcatcgc caacaaggcg       420
     gaccgcatcg tcggcgagat gtcgcatggc gaccagcgcg tggtggaaat cggcatcgcc       480
     ctgtcgcgcc atccgcgcct gctcctgctc gacgagccga ccgccggcat gggggatgag       540
     gaaacgcacc acatgaccga cctgatccgc cggctcaaca aggaccaggg catcaccatg       600
     ctcttcgtcg agcacgacat ggcgatcgtc ttcggcatcg ccgaccgcat caccgtgctc       660
     gacaacggca ccttcctcgc cgagggcacg gcggcggaaa tctccgccaa cccgcgcgtc       720
     cagagcgcct atctcggaac cgccatcgag gagaccgccg catga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page