(data stored in ACNUC7421 zone)

EMBL: CP000690.PE158

CP000690.PE158       Location/Qualifiers
FT   CDS_pept        complement(172336..173322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3458"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29062"
FT                   /db_xref="GOA:A5FTY0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY0"
FT                   /protein_id="ABQ29062.1"
FT                   /translation="MSTALDTKPATRPAPSIGGREISAAIIWLALLFVPIWLPAIGGFT
FT                   DLASRVLVYAMAATGLNLLLGYTGGLSFGHAAYFGLGAYGTGLFIIHVIPSMPLALIAG
FT                   TLLGGIGGILVGPMVMKRKGIYFAMITIAFGQMFYFLAVRWNTVTGGEDGLTGFSRVPL
FT                   HLGGEAINLGPARFYYVVLALFAVVMLVVWQILRSPMGHAFVATRENTTRLRFLGVAVD
FT                   KQVWVAFAISAFITALAGSLNAMLTAFASPDDLQWQLSGSFVVICVLGGMRSFWGPFLG
FT                   AVIYIAAQDYLSSVTQNWMSFIGLIFVLSVLFFPQGLLGFIKGRARS"
     atgagcactg cactcgacac caagccggcc acgcggcccg cgccctcgat cggcgggcgc        60
     gagatttcgg cagcgatcat ctggctcgcc ctgctcttcg tcccgatctg gctgcccgcg       120
     atcggcggtt tcaccgatct cgcctcccgc gtgctggtct acgcgatggc cgcgaccggg       180
     ctgaacctgc tgctcggcta caccggcggc ctgtccttcg gccatgcggc ctatttcggc       240
     ctcggcgcct atggcaccgg cctgttcatc atccatgtca ttccctcgat gccgctcgcc       300
     ctcatcgccg gcacgctgct cggcggcatc ggcggcatcc tggtcgggcc gatggtgatg       360
     aagcgcaagg gcatctactt cgcgatgatc accatcgcct tcggccagat gttctacttc       420
     ctcgcggtgc gctggaacac cgtcaccggc ggcgaggatg gtctgaccgg cttctcccgc       480
     gtgccgctgc atctcggcgg cgaagccatc aatctcggcc cggcgcgctt ctattatgtc       540
     gtgctggcgc tattcgcggt ggtcatgctc gtcgtctggc agatcctccg ctcgccgatg       600
     ggccatgcct tcgtcgccac ccgcgagaac accacccgcc tgcgctttct cggcgtcgcg       660
     gtggacaagc aggtctgggt cgccttcgcg atctcggcct tcatcaccgc gctcgccggc       720
     agcctgaacg cgatgctgac cgccttcgcc tcgccggacg acctgcaatg gcagctctcc       780
     ggctccttcg tcgtcatctg cgtgctcggc ggcatgcgca gcttctgggg gccgttcctc       840
     ggcgccgtca tctacatcgc ggcgcaggac tacctctcca gcgtgaccca gaactggatg       900
     agcttcatcg gcctgatctt cgtcctgtcg gtgctgttct tcccgcaggg cctgctcggc       960
     ttcatcaagg ggagggcgcg gtcgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page