(data stored in ACNUC7421 zone)

EMBL: CP000690.PE159

CP000690.PE159       Location/Qualifiers
FT   CDS_pept        complement(173319..174188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3459"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29063"
FT                   /db_xref="GOA:A5FTY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY1"
FT                   /protein_id="ABQ29063.1"
FT                   /translation="METLLVYSAFNGLVVGIFYALMALGLSLILGLNGIINFAHGTFMA
FT                   LGGYLAFTLEPYIGFWGGLLVAPLLAVVVGVVTERVLIRPLYGRDPLFSLLLTFGLAMI
FT                   MQDMIRTIWGSIGQPFALPNYLNSPLSSSMFFLTGFRIVVILITVLVTGALFAVLRFSR
FT                   IGIRIRAGNADLETISSLGVNIFFLRAVNFGIGIFLAGVAGILAAGQLGLSPTIGDSLI
FT                   MPAFVAIIVGGVGSLMGSVLGGLIIGIASGLTAAFYPVAQEVVIYVIMAVVLVIRPRGL
FT                   LGQEGLFE"
     gtggaaactc tgcttgtcta cagcgccttc aacgggttgg tggtcggcat cttctatgcg        60
     ctcatggcgc tgggactgtc gctgatcctc ggcctgaacg gcatcatcaa tttcgcccat       120
     ggcaccttca tggcgctcgg aggctatctc gcctttaccc tcgaacccta tatcggcttc       180
     tggggcgggc tcctcgtcgc cccgctgctg gcggtggtgg tcggggtcgt gaccgaacgg       240
     gtgctgatcc gcccgctcta cgggcgcgat ccgctgttct cgctgctgct gaccttcggc       300
     ctcgcgatga tcatgcagga catgatccgc accatctggg gctcgatcgg gcagcccttc       360
     gccctgccga actacctcaa ctcgccgctc agctcctcga tgttctttct caccggcttc       420
     cgcatcgtgg tcatcctgat caccgtgctg gtcaccggcg cgctgttcgc ggtgctgcgg       480
     ttcagccgca tcggcatccg catccgcgcc ggcaatgccg atctcgaaac catctcctct       540
     ctcggcgtga acatcttctt tctgcgcgcg gtgaatttcg gcatcggcat cttccttgcc       600
     ggcgtcgccg gcatcctcgc cgccggccag ctcggcctgt cgccgacgat cggtgattcg       660
     ctgatcatgc cagccttcgt cgccatcatc gtcggcggcg tcggcagcct gatgggcagc       720
     gtactcggcg ggctgatcat cggcatcgcc tccggcctca ccgcggcctt ctacccggtc       780
     gcgcaggaag tcgtcatcta cgtcatcatg gcggtggtcc tggtcatccg cccccgcggc       840
     ctgctcggcc aggaaggtct gttcgaatga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page