(data stored in ACNUC7421 zone)

EMBL: CP000690.PE16

CP000690.PE16        Location/Qualifiers
FT   CDS_pept        complement(21035..21919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3308"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3308"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28920"
FT                   /db_xref="GOA:A5FTI8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI8"
FT                   /protein_id="ABQ28920.1"
FT                   /translation="MIWEVAVDASDLKMFEAVARLGSMKRAAAELNTVQSNVTARIKAL
FT                   ENDLGISLFQRHARGVTITGPGQRMLPFAGQITKLLADARAAAKDDGTPNGPLKIGSLE
FT                   TTTAMRLAPLLSNFTLAYPEVQLVVTTGTTAQLVTELLEYRLDGAFVAGPVEHPDLDRQ
FT                   VVFIEELVLVTSPSVTDPSSLTKCGTLRTIVFQYGCSYRQKLEAVLSGMGIANARPLEL
FT                   GSLDAMIACVSAGVGVTLLPRRVVAHAASEGNVSAHALPQIHANVETLFIRRKDTYVSS
FT                   AMRAFLELCDTQT"
     atgatatggg aggttgctgt ggacgcatcc gatctcaaaa tgttcgaagc cgtcgcccga        60
     ctgggcagca tgaaacgggc tgccgcagag ctaaataccg tgcagtccaa cgtgacggcc       120
     aggatcaaag cgctggagaa tgatctcggc atctccttgt tccagcgcca cgcacgcggt       180
     gtcacgatta ccgggccagg ccagcgaatg ctgcccttcg ccggacagat aacaaagtta       240
     ctggccgatg cccgggcggc tgcgaaggat gacggcacgc caaacggtcc gctaaaaatt       300
     ggcagcctcg agacgacgac ggccatgcgc ctcgccccgc tgctcagcaa cttcaccctt       360
     gcctaccccg aagtccagtt ggtcgtgacc acgggcacga ccgcacagct ggtgacggag       420
     ttgctcgaat acaggttgga tggcgctttc gttgcagggc cggtggagca cccggatttg       480
     gaccggcagg tagttttcat tgaggaattg gtcctcgtta cctcgccctc cgtcactgac       540
     ccctcgtcgc tgacgaagtg tggcactttg cggacaatcg ttttccaata tggctgttcc       600
     tatcgacaga aactggaagc ggttttgtcg ggtatgggga tcgccaatgc cagaccactt       660
     gagcttggtt cgctcgacgc catgatcgcc tgtgtctcgg ccggagttgg agtgacgcta       720
     ttgccccgga gggtcgttgc ccatgcggcg agcgagggca atgtctcggc gcatgcattg       780
     ccgcaaatac acgcaaatgt ggaaacgctc ttcattcggc ggaaggatac ctatgtctcc       840
     agcgccatga gggcgttcct cgaattatgc gacactcaga catag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page