(data stored in ACNUC7421 zone)

EMBL: CP000690.PE160

CP000690.PE160       Location/Qualifiers
FT   CDS_pept        complement(174309..175562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3460"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3460"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29064"
FT                   /db_xref="GOA:A5FTY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY2"
FT                   /protein_id="ABQ29064.1"
FT                   /translation="MKSLNPGSLDRRGLLKAAGATGASSLILPNISWAASEKPVKIGMI
FT                   DPRTGTYAAAGFSEIHGATMAIDEINKKGGILGRPVQMFVEDSESLPGPGVTKAQKLVA
FT                   EDKVNFLMGAVNSATAESLSQFALQHNMLYIDTGGHVDDVTGSKCHWTTFRTCSTTWML
FT                   TAGDFETLFKKFGKKWFFITPDYAFGHAEHRDYVKQLQKAGGKSVGNALAPLGTTDFSS
FT                   YLIRARAAKPDVLICLQAGDDLVNLLKQAVQFGLDKQMAIAGALQEMEVLESLPKAALL
FT                   GWWTFEWYWNQPGVPHVADFVTAYKRRFGDKVPTARSWFGYVSAHSIALAANQAKTLDS
FT                   LKVVKALEGMELPPEIALQPGKVHYRAGDHQMMANMFPGYVPKDASYPNLFKVADVVPS
FT                   EKIALSPAAAGCKMTYPS"
     atgaaatcgt taaatcctgg atcgttagac cgtcgagggt tgcttaaagc cgctggtgca        60
     accggtgctt caagcttaat tctgccaaat atcagctggg ctgccagtga gaagccagtc       120
     aaaatcggca tgatcgatcc gcgtacgggt acatatgcgg ctgctgggtt tagcgagatt       180
     catggcgcaa caatggctat cgacgagatc aacaagaagg gcggcattct cggccggccc       240
     gttcagatgt tcgttgaaga ttcggaaagc ctgccaggtc ctggagtgac gaaagcgcaa       300
     aagcttgttg ctgaggacaa agtcaatttt ctgatgggag cagttaactc agctacggca       360
     gaatcactta gtcaattcgc attgcagcat aatatgctct atattgatac tggtggtcac       420
     gtagatgacg tgaccggcag caaatgtcat tggaccacat tccgcacctg ctcgaccaca       480
     tggatgctta cggccggtga cttcgagacc ctattcaaaa agtttggcaa gaagtggttc       540
     tttattacac ctgactatgc ttttggtcat gctgagcata gggattatgt aaagcaactt       600
     cagaaggcgg gtggcaaatc ggtaggcaat gcgcttgcgc cactcggcac cacggacttc       660
     tcctcctacc tgatccgcgc ccgcgccgcg aagccggacg tgctgatctg cctgcaggcg       720
     ggcgacgacc tcgtgaacct gctgaagcag gccgtgcagt tcggcctcga caagcagatg       780
     gcgatcgccg gcgcgctgca ggaaatggag gtcttagagt ctcttccgaa ggcagccctt       840
     ctcggctggt ggaccttcga gtggtactgg aaccagcccg gcgttcccca cgttgccgac       900
     ttcgtcacgg catataagcg tcgatttggt gacaaagtcc caaccgctcg gtcttggttc       960
     ggttatgtaa gcgctcattc catcgccctt gcggcgaatc aggcgaagac gctcgactcg      1020
     ctgaaggtgg tcaaggcgct cgaaggcatg gaactgccgc cggagatcgc gctgcagccg      1080
     ggcaaggtgc actaccgcgc cggtgaccat cagatgatgg cgaacatgtt ccccggctac      1140
     gtccccaagg acgcgagcta tccgaacctg ttcaaggtgg ccgacgtggt gccgagcgag      1200
     aagatcgccc tgtcgccggc cgccgccggc tgcaagatga cgtacccgag ctga            1254
//

If you have problems or comments...

PBIL Back to PBIL home page