(data stored in ACNUC7421 zone)

EMBL: CP000690.PE162

CP000690.PE162       Location/Qualifiers
FT   CDS_pept        complement(177004..178908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3462"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; Cl- channel,
FT                   voltage-gated family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3462"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29066"
FT                   /db_xref="GOA:A5FTY4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY4"
FT                   /protein_id="ABQ29066.1"
FT                   /translation="MPFIHRQTPRRIQLGDFTTDRGIFRLIGFGACAGLFGVIAGWILL
FT                   RMIGLINDLAYYGVWSTRMLAPGGAAPGGHPALWTILVPAGGAVAIGLMARYGSEKIRG
FT                   HGIPEAIEAILLGGARLDLRVAILKPISSAISIGTGGPFGAEGPIIMTGGAAASLMAQC
FT                   FTLTDAERKTLLVAGACAGMTAVFGTPVAALLLAVELLLFELKPRSIIPVATACITAAI
FT                   LRRLCMTPAPLFPYAGGVIVDPLHALGWLGLGLAAGLGSALLTVLVYAAEDGFETLPIH
FT                   WMWWPVLGGLVVGIGGVFDPAALGVGYPDIARLLAGTLAGGAAIRLVLVKGVIWSVALG
FT                   SGTSGGVLAPLLIIGGALGAVLAPVMPHAAPGFWAVLGMAAMMGGTMRAPLTSTLFAVE
FT                   LTGNHLILLPVLAASMASMAVTVLLMKRSILTEKIARRGHHLTREYSIDPLAVTRIRDI
FT                   MATKVDTLAADLPVGAAIERFLSHAAAHRAFPVTAPDGLVLGLVSRADILDWIGDEVRR
FT                   DLPLRAMIAGREVTTAAPDEMADTIAVRMLTRNAPRIPVVDAEGRLLGIVSRADLLRVH
FT                   QRVMLAETRRERFFLQGLFSSRKNRIQNVPGMQNAEPQMIPILVNQNGAQNDVDTELR"
     atgccattta tacatcgcca gacgccgcgc cgcatccagc ttggcgactt cacgaccgac        60
     cgcgggatct tccggctgat cggcttcggc gcctgcgccg gcctgttcgg cgtcatcgcc       120
     ggctggatcc tgctgcgcat gatcgggctg atcaacgacc tcgcctatta cggcgtctgg       180
     tcgacccgga tgctggcgcc gggcggcgcc gcgccgggcg gccatcccgc gctgtggacg       240
     atcctcgtcc ccgccggcgg cgccgtggcg atcggcctga tggcgcgcta cggctcggag       300
     aagatccgcg ggcacggcat ccccgaggcg atcgaggcga tcctgctcgg cggcgcccgg       360
     ctcgacctgc gtgtggccat cctcaagccg atctcctcgg cgatctcgat cggcaccggc       420
     ggcccgttcg gcgccgaggg gccgatcatc atgaccggcg gcgccgccgc ctcgctgatg       480
     gcgcagtgct tcaccctgac cgatgccgag cgcaagaccc tgctcgtcgc cggcgcctgc       540
     gcgggcatga cggcggtttt cggcaccccg gtcgccgccc tcctgctcgc ggtcgagctc       600
     ctgctgttcg agctgaagcc gcgcagcatc attccggtcg ccaccgcctg catcaccgcc       660
     gcgatcctcc gccgcctctg catgacgccg gcgccgcttt ttccctatgc cggcggagtg       720
     atcgtcgatc cgctgcacgc cctcggctgg ctcggcctcg gccttgccgc cgggctcggc       780
     tccgccctgc tcaccgtgct cgtctacgcc gccgaggacg ggttcgagac actgccgatc       840
     cactggatgt ggtggccggt gctgggcggc ctcgtcgtcg gcatcggcgg cgtattcgac       900
     ccggcggccc tcggcgtcgg ctatcccgac atcgcgcgcc tgctcgccgg cacgctcgcc       960
     ggcggggccg cgatccgtct cgtcctggtc aagggcgtga tctggtcggt ggcgctgggc      1020
     tcgggcacct cgggcggcgt gctcgcgccg ctgctgatca tcggcggcgc gctcggcgcg      1080
     gtcctcgccc ccgtcatgcc gcacgccgcc cccggcttct gggcggtgct cggcatggcg      1140
     gcgatgatgg gcggcaccat gcgcgccccg ctgacctcga cgctgttcgc cgtcgaactc      1200
     accggcaacc acctcatcct cctgccggtg ctcgccgcca gcatggccag catggcggtg      1260
     accgtcctgc tgatgaaacg ctcgatcctg accgagaaga tcgcccggcg cggccatcac      1320
     ctcacccgcg aatacagcat cgacccgctg gccgtgaccc gcatccgcga catcatggca      1380
     accaaggtgg acacgctggc ggcggacctg ccggtggggg ctgcgatcga gcgcttcctc      1440
     tcgcacgcgg cggcccaccg cgccttcccg gtgacggcgc cggacggcct cgtgctcggc      1500
     ctcgtctccc gcgccgacat cctggactgg atcggcgacg aggtgcggcg cgacctgccc      1560
     ttgcgcgcga tgatcgccgg ccgcgaggtg acgaccgccg cgcccgacga aatggccgac      1620
     accatcgcgg tgcggatgct cacccggaac gccccgcgaa tccccgtggt cgacgcagaa      1680
     ggccgcctcc tcggcatcgt ctcccgcgcc gacctgctgc gcgtccacca gcgcgtcatg      1740
     ctcgccgaaa cccgccgcga acgctttttt ctacagggac tgttttcttc tcgcaagaat      1800
     agaatacaga atgttccagg aatgcaaaat gcagagccac aaatgattcc gattctggtc      1860
     aatcagaacg gcgcacaaaa tgatgtagac actgaattgc gatga                      1905
//

If you have problems or comments...

PBIL Back to PBIL home page