(data stored in ACNUC7421 zone)

EMBL: CP000690.PE163

CP000690.PE163       Location/Qualifiers
FT   CDS_pept        complement(180267..181043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3464"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29067"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY5"
FT                   /protein_id="ABQ29067.1"
FT                   /translation="MNRACVVADRGMVSADTIAALDALGMEYILGARERTSRVIRDVVL
FT                   KDKAAMVPLVLDRQHGETQLWVKEIRIGKGKAAQRYIVTVNEAEAKKDREDRQAIIDGL
FT                   QAQLKKGDKALVGNSAYRRYLRSRGNAFEIDPGKLAEEARFDGLSVLRTLFRAAKASFD
FT                   TRPVFHQADAAIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEK
FT                   GGKVITTRTHVTGQVGNVFKAAGIALPHNISEHPAD"
     ttgaaccgcg cctgcgtggt cgccgaccgc ggcatggtca gcgccgatac catcgcggca        60
     ctggacgcgc tggggatgga atacatcctc ggcgcgcgcg agcgcaccag ccgggtgatc       120
     cgcgacgtcg tgctgaagga caaggccgcg atggtcccgc tcgtgctcga tcgccagcat       180
     ggcgagaccc agctgtgggt gaaggagatc cggattggca agggcaaggc ggcccagcgc       240
     tacatcgtca cggtcaatga ggccgaggcg aaaaaggaca gggaggaccg ccaggccatc       300
     atcgacgggc tgcaggccca gctgaagaag ggcgacaagg cgctggtcgg gaactcggcc       360
     taccggcgtt atctccgcag ccgcggcaac gccttcgaga tcgatccggg caagctggcc       420
     gaggaggccc gcttcgatgg cctcagcgtg ctcaggaccc tgttccgcgc cgccaaggcc       480
     agcttcgata cacggccggt ctttcaccag gctgacgccg cgatccgcgg ccacgttttc       540
     tgttccttcc tggccctgac actcgccaag gaactgaacc gcctgtgcgg cgccaggggc       600
     ttccagcccg aatggcagaa gttgctgaac gatctcgaca ggctccagca ggcaaccatc       660
     gaaaagggcg gcaaggtcat caccacgagg acccacgtca ccggccaggt cggcaatgtc       720
     ttcaaggccg ccggcatcgc gctgccccac aacatcagcg aacaccccgc agactga          777
//

If you have problems or comments...

PBIL Back to PBIL home page