(data stored in ACNUC7421 zone)

EMBL: CP000690.PE164

CP000690.PE164       Location/Qualifiers
FT   CDS_pept        complement(181079..181648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3465"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29068"
FT                   /db_xref="GOA:A5FTY6"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY6"
FT                   /protein_id="ABQ29068.1"
FT                   /translation="MSGYRSRSSRFPNVFGRDRAPRWRLLTGAAIAGLLAASAVALAQP
FT                   WGAGWGGGMMGGMGGMMGIGVGLMWQGLYGTPRRDWISSLSPDPFVHPIPMAITAAAGL
FT                   VLLTALICFVVVTVGTLASRPVVASEVTEIPFGNAPVAEDSRWVRLMDRLGLWTLVAFL
FT                   LILAVYGPLFAVLLSHQVSIPPNTAY"
     atgagcggat accgcagcag atcgtcacgg tttccgaacg tcttcggtcg cgaccgcgcg        60
     cctcgctggc gtcttctgac cggtgccgcg atcgcgggcc tgctcgctgc gtcggcggtc       120
     gcgcttgccc agccgtgggg agccggatgg ggcggcggga tgatgggcgg catgggtggg       180
     atgatgggca ttggcgtcgg gctaatgtgg caggggcttt acggcactcc gcggcgcgat       240
     tggatcagct cgctttcacc cgatccgttc gtccatccga tcccgatggc gatcaccgct       300
     gcagccggcc tggtgctgct gactgccctg atatgcttcg tggtggtaac ggttggcaca       360
     ctggcgtcac gacccgtagt tgcttcagag gtgacggaaa tcccctttgg caatgctccc       420
     gttgctgaag actcgcgctg ggtgcggctg atggaccggc tgggtttgtg gaccctggtg       480
     gcctttcttc ttatcctcgc ggtctacggg cccctattcg ccgtcctgct ttcgcatcag       540
     gtatcgatcc cgccgaatac ggcgtattga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page