(data stored in ACNUC7421 zone)

EMBL: CP000690.PE166

CP000690.PE166       Location/Qualifiers
FT   CDS_pept        complement(182982..183713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3467"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29070"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY8"
FT                   /protein_id="ABQ29070.1"
FT                   /translation="MILRQFLHTDPTAASYLLGCVGKGAGVVVDPLFPIEPYLHAASAS
FT                   GSPIHLVIDTHLHADHRSAGRALAEAAGAEYAIHESAEVGYACRRLADGERLEIGNVVL
FT                   EVLHTPGHTPEHLCLTVTDRTRADEPWSVLGGHTLMVGDVGRTELATDAARGARDLFAS
FT                   LVRLKALPDHIEVLPGALAGSVCGRGLSGKPVSTIGFERRHNPAFRIDDAERFVAFMLE
FT                   NIPPAPDGAAELRAWNAGFTA"
     atgatcctgc gacagttcct gcacaccgat cccacggcgg cctcctatct gctcggctgt        60
     gtcggcaagg gcgccggcgt ggttgtcgac ccgctgtttc cgatcgaacc ttatctgcac       120
     gccgcctcgg cctccggctc gccgatccac ctcgtgatcg acacgcatct gcatgccgat       180
     caccgctccg ccggccgcgc gctggccgaa gcggccggcg ccgaatacgc catccacgaa       240
     tccgccgagg tcggctatgc gtgccgccgc ctcgctgacg gcgaacggct cgaaatcggc       300
     aatgtcgtgc tcgaggttct gcacacgccc ggtcacacgc cggagcatct ctgcctcacg       360
     gtgaccgatc gcacccgcgc agatgagcca tggagcgtgc tcggcggcca cacgctcatg       420
     gtgggcgatg tcggccggac cgagcttgcg accgacgccg cgcgcggcgc gcgcgacctc       480
     ttcgccagcc tcgtccggct caaggcgctg ccggatcata tcgaggtgct acccggtgct       540
     ctggctggct ctgtctgtgg ccgaggtctc tcgggcaaac cggtgtccac catcggcttt       600
     gagcggcggc acaaccccgc cttccgcatc gacgatgccg agcgcttcgt cgccttcatg       660
     ctcgagaata tcccgcccgc ccccgatggc gcagccgaac tgcgtgcctg gaatgcgggc       720
     ttcaccgcgt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page