(data stored in ACNUC7421 zone)

EMBL: CP000690.PE167

CP000690.PE167       Location/Qualifiers
FT   CDS_pept        183799..184464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3468"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: Rhodanese domain protein; regulatory protein,
FT                   ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29071"
FT                   /db_xref="GOA:A5FTY9"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTY9"
FT                   /protein_id="ABQ29071.1"
FT                   /translation="MKSSSGPKQQIFSHLAEIAAALAHPHRIEIIELIAQGERSVEDLA
FT                   ERIGLSLSNTSRHLQVLRRARLAAPRREGKNMFYSLVSETEVVTLLGSLGRVGERNIAE
FT                   IDQVLQAYFRARDCLEPVSRLALLERLRDGSVTLLDVRPADEFARGHLPGALNIPLDQL
FT                   DAALGGFTENVQVVAYCRGPYCVLSYDAVAQLRARGVRAIRLEDGYPEWKAAGLPVET"
     atgaagtcaa gcagcggtcc aaagcaacag attttcagcc atctcgccga gatcgccgcg        60
     gcgcttgcgc atccgcacag gatcgaaatt atcgaactga tcgcccaagg tgagcgcagc       120
     gtggaggatc ttgccgaacg gattggcctg tcgctctcga acacgtcccg ccacctgcag       180
     gtcttgcgcc gtgcccgcct tgcggcgccg cggcgagagg gcaagaacat gttctatagc       240
     ctggtctccg agaccgaggt ggtgacgttg ctgggcagcc tgggtcgagt gggcgaacgg       300
     aacatcgcgg aaatcgacca ggtgctgcag gcgtatttcc gggcgcggga ttgtctcgag       360
     cccgtatcgc gcttggccct gcttgaacgc ctccgggacg gcagcgtgac actcctcgat       420
     gtccggccgg cggacgagtt cgcccggggc cacttgccgg gtgcgttgaa cattcccctc       480
     gatcagctgg atgcggcgct gggcggcttc accgagaatg tccaggtcgt cgcgtattgc       540
     cggggaccct attgcgttct gtcatatgac gccgtggcgc agttacgggc gcgtggcgtg       600
     cgggccatcc gactggagga tggttatccg gagtggaagg cggcgggctt acccgtcgag       660
     acttga                                                                  666
//

If you have problems or comments...

PBIL Back to PBIL home page