(data stored in ACNUC7421 zone)

EMBL: CP000690.PE169

CP000690.PE169       Location/Qualifiers
FT   CDS_pept        complement(186235..187143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3470"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29073"
FT                   /db_xref="GOA:A5FTZ1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTZ1"
FT                   /protein_id="ABQ29073.1"
FT                   /translation="MNESIRTAAISPLRQRLIDDMNMRRFSRETHRNYLRDVGRFATFL
FT                   GRSPDTATAEDLRRFQIEQRDAGVPTPTMNSIVSALRFFFTQTIDRPDLARKLIRTPHP
FT                   RNLPVVLSRDEVARLLNATTCLKHQAALSVAYGAGMRVAEVAALKVSDIDSERMLIRVE
FT                   RGKGGRYRNAILPADLLILLREWWKIGHQQGVMHAQGWLFPGQQVTKPISTRQLHRVVV
FT                   EAARAAEITKRVGPHTLRHSFATHLLEDGVDIRVIQALLGHSHLNTTALYTKVATRTVR
FT                   AVISPLDRLGIVTADQERPAG"
     atgaacgaat caatccgcac tgctgcgatc agcccgctgc gccagcgttt gatcgacgat        60
     atgaacatgc gtcggttctc gcgagagaca caccgcaatt accttcgtga cgtggggcgc       120
     ttcgccacat tcctggggcg ttcacccgat acggcgacgg cggaagatct tcgccgcttc       180
     cagatcgagc agcgcgatgc cggggtgccg acaccgacca tgaacagcat cgtctcggcg       240
     ctacggttct ttttcacgca aacgatcgac cggcctgatc tggcgcgcaa gctgatccgg       300
     acgccgcacc ctcgcaacct gcccgtcgtg ctcagtcggg atgaggtcgc acggctgctc       360
     aacgcgacca cctgcctcaa gcatcaggcg gctctttcgg tcgcttatgg tgccggcatg       420
     cgcgtggccg aggtcgcggc actgaaggtc agcgacatcg acagcgagcg catgctgatc       480
     cgcgtcgagc ggggcaaagg gggccgatat cgcaatgcca tcctgccagc ggatctgctg       540
     atcttgctgc gtgaatggtg gaagatcggc catcaacagg gcgtgatgca cgcacaaggc       600
     tggctgttcc cgggccagca agtgacgaag ccgatcagca cccggcagtt gcatcgcgtc       660
     gtcgtcgagg cggcacgggc cgcggagatc accaagaggg tcggcccgca cacgctgcgc       720
     cacagcttcg cgacccacct gctggaagac ggcgtcgata tccgcgtgat ccaggccctg       780
     ctcggccaca gccacctcaa taccaccgcg ctctacacca aggtcgccac gcgcaccgtg       840
     cgcgccgtga tcagtccgct ggacaggctg gggatcgtga ccgccgacca ggagcgcccc       900
     gccggctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page