(data stored in ACNUC7421 zone)

EMBL: CP000690.PE17

CP000690.PE17        Location/Qualifiers
FT   CDS_pept        22010..23197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3309"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3309"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28921"
FT                   /db_xref="GOA:A5FTI9"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI9"
FT                   /protein_id="ABQ28921.1"
FT                   /translation="MDVSGVRNQTGSQTGRAWMGIFSGFCASLVGIGMARFAYTPLLPA
FT                   IIGAHWFQPSAAAYLGAANLAGYLAGALAGRPLATRMTAPSALRTMMFLATSSFFACAY
FT                   PLGFSWFFVWRFCAGLAGGVLMVLAAPTVLPHLPSSRRGLAGGVIFMGVGVGIAASGTF
FT                   VPLLLNQGLQRSWVGLGAISLLLTLASWVGWPAEEIVPRSKPHKIPGTVALRALYVEYA
FT                   LNAVGLVPHMLFLVDFVARGLGNGIRTGAEYWVLFGLGAVVGPILSGHLADRLGFARFL
FT                   RVSYLVEAAAVLLPALGGGAAWLMLSSAVVGAFTPGIVPLVLGRVHELLAHHPAGQNAA
FT                   WSKATVSFATFQAAAAYGLSYIFAQTGDYRQLFIIGAVAMLLAFAIDVLAGGKIQ"
     atggacgtat caggtgtcag aaatcagacc ggaagccaga caggccgggc ctggatggga        60
     attttctcgg gtttctgcgc gagcctcgta ggtattggca tggcgcggtt cgcttatacg       120
     cccttgctac ccgccattat cggggcacac tggttccagc cttcagccgc ggcataccta       180
     ggagcagcca atctcgctgg ctatctggcg ggggcgctgg ccgggcggcc acttgcgacg       240
     cgaatgaccg ccccctcggc acttagaacc atgatgtttc tggcgacatc atccttcttc       300
     gcctgtgcct atccgctggg cttttcgtgg ttcttcgtct ggcgcttttg cgcaggtctt       360
     gcaggtggtg tgctgatggt tctggcagcg cccaccgtat tgccgcattt gccatcgtcc       420
     cgtcgcggcc ttgccggcgg tgttatcttc atgggtgttg gagtgggaat cgctgcgtcc       480
     ggcacgttcg tgccgttact attgaaccaa gggctgcaac ggagctgggt agggcttggt       540
     gctatctccc tgttgctgac gctggcttcc tgggtcggtt ggccagctga ggaaatagtg       600
     ccgcgaagca agcctcataa aatccccggc accgttgcct tgcgggcgct ctacgtcgaa       660
     tacgcgctca acgccgttgg gttggtgccg catatgctgt tcttggtaga tttcgttgcg       720
     cgcgggttgg ggaatggcat acgcacagga gcggaatact gggtgctttt cggcctgggt       780
     gccgtggtcg ggccgatcct cagcgggcac ttggctgatc ggctggggtt tgcgcgcttt       840
     ctgcgggtat cttatctcgt ggaagccgcc gccgtactac tgccagccct aggtggaggg       900
     gcggcttggc taatgctttc cagcgccgtc gttggcgcgt tcacgccggg tatcgtgccg       960
     ctggtgctgg ggcgcgtgca tgaactgctc gctcatcatc cggccgggca aaatgccgct      1020
     tggagcaaag ctactgtgag ctttgccaca tttcaggcag cggcggccta tggcctctcg      1080
     tatatcttcg cgcagacggg tgactaccgg cagcttttca tcatcggcgc cgttgccatg      1140
     ttgctggctt tcgctatcga tgtgctcgca gggggcaaga tacaatga                   1188
//

If you have problems or comments...

PBIL Back to PBIL home page