(data stored in ACNUC7421 zone)

EMBL: CP000690.PE19

CP000690.PE19        Location/Qualifiers
FT   CDS_pept        complement(24631..25020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3311"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28923"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ1"
FT                   /protein_id="ABQ28923.1"
FT                   /translation="MADIWPSVSTSGTSWVRGRRRATSLVCRRADAGCLILYAQDLLGR
FT                   GRAEWYFVEMRHRHLIHEEYTLAAIDDIISRGRWNDWSELRDAARADPKVLERITRVCM
FT                   ANVGDPYAQRYFFWMNYAQEHRSAA"
     atggccgata tatggccgtc ggtgagcaca agcgggacat cgtgggtccg tggccggagg        60
     agagcgacga gcctggtatg tcgccgggct gatgccggat gcctgatcct gtatgcacaa       120
     gatctccttg ggcgaggccg tgcagagtgg tattttgtcg aaatgcgtca tcgacacctc       180
     attcacgagg aatacacact ggcggcgatc gacgacatca tttcgcgcgg ccgatggaat       240
     gactggtcag agctaagaga cgcggcgaga gccgatccaa aggtgctgga gcgaatcact       300
     cgtgtctgca tggcaaatgt cggcgaccca tacgcgcagc gttatttttt ctggatgaat       360
     tatgcccaag agcaccgctc agctgcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page