(data stored in ACNUC7421 zone)

EMBL: CP000690.PE2

CP000690.PE2         Location/Qualifiers
FT   CDS_pept        complement(3287..4855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3293"
FT                   /product="Nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3293"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28906"
FT                   /db_xref="GOA:A5FTH4"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH4"
FT                   /protein_id="ABQ28906.1"
FT                   /translation="MPRVVSLFLPNWPIDRYNRDRRASAQRPGQPVSGLVDTAPPSPET
FT                   PLILADRDGNRRIVFAANGVAQDLGLRIGMAVAQAQALIPGLTIRDAEPLADVAGLERL
FT                   ALWALHRYAPIVAADPPDGLVIDATGAAHLRGGEAQMLRDMIARLAAAGVTARAAMADS
FT                   WGAAHALARFLANPVFVALADQSRDILLTLPIAALRLPTEMITGLRRLGFERIGDLADQ
FT                   PRAPLALRFGPQLHRRLDQALGTLAEAIEAARSPDLIEVRQNFAEPIGAAETIARYTGI
FT                   LVTELCTMLEAKGLGARQLDLVFHRVDAHSEAIRVGTALPARNAKRLTRLLCDKIETID
FT                   PGFGIEIMALCAARSEPFGPKQLTSLLADEPETDISDLIDTIANRVGGDRLYRFAPVAS
FT                   DVPERSLSRIAATAPPTKMNWPDHWPRPTRLLPNPEPIETVALLPDHPPVNFTWRGIRR
FT                   RVKRADGPERVFGEWWKRDAELIAVRDYFRIEDDAGERFWVFRAGDGEDNATGSHRWFL
FT                   HGIFG"
     atgcccaggg tcgtctcgct gtttctgccg aactggccga tcgatcgata caatcgggac        60
     cggcgcgcct cggctcagcg gcctgggcag ccggtgtcgg ggctcgtgga taccgcacca       120
     ccgtcacctg agacaccact gatcctcgcc gatcgggacg gcaatcgacg gatcgttttc       180
     gcagccaatg gtgtggcgca agatcttggc ctgcggatcg gcatggcggt ggcccaggcg       240
     caggccctga ttcccggctt gacgatcagg gacgcggaac cgctggcgga tgtggcaggg       300
     ctcgagcgcc tggcgctatg ggcgctgcac cgctacgcgc cgattgttgc ggccgatccg       360
     ccggacgggc tggtcatcga tgcgactggg gcggcccacc tgcggggtgg cgaggcacag       420
     atgctgcggg acatgatcgc ccgcttggcc gctgccggag tgaccgctcg cgctgcgatg       480
     gcggatagct ggggggcggc gcatgcgctg gcgcggtttc tcgcgaaccc ggtgttcgtc       540
     gcgctggcag accagtcgcg cgacatcctg ctcacactac caattgccgc cttgcgcttg       600
     ccgacggaga tgatcaccgg tttgcgccgg ctggggtttg aacggatcgg cgatctggcc       660
     gatcaaccgc gcgcaccgct cgccctgcgg ttcggtccgc aactgcaccg caggctggat       720
     caggcgttgg gcactttggc cgaggcgatt gaagcggcgc ggtcaccgga tctgattgag       780
     gtgcgacaaa atttcgccga accgatcggt gccgcggaga ccatcgcccg ctataccggg       840
     attctggtca ccgaactttg caccatgctt gaggccaaag ggctcggcgc gcgacaactc       900
     gatcttgtgt ttcatcgggt cgatgcgcac tccgaggcga tccgcgtcgg caccgctttg       960
     ccggcgcgaa acgccaaacg cttgacccga ctgctatgcg acaaaatcga gacgatcgat      1020
     cccggctttg gtatcgagat catggcgctc tgcgccgcac ggtccgaacc gttcgggccg      1080
     aagcagttga catcgctgct cgcggatgaa ccggagaccg acatctcgga tctgatcgat      1140
     accatcgcca atcgggtcgg cggcgaccgg ctgtatcggt ttgcgccggt ggcgagcgat      1200
     gtgcctgaac gatccttgag ccggatcgcg gcgaccgcgc cgccgaccaa aatgaactgg      1260
     ccggatcatt ggccccggcc gacgcgcctg ctgccaaacc ccgaaccgat cgagaccgtt      1320
     gcattgcttc ccgaccatcc gccggtcaac ttcacgtggc gcggcatccg ccggcgcgtc      1380
     aaacgcgcgg acggacctga gcgggtattt ggcgaatggt ggaaacgcga cgccgagttg      1440
     atcgcagtgc gggattattt ccggatcgag gatgacgccg gcgagcgatt ctgggtgttc      1500
     cgggcggggg atggcgagga taacgccacc ggctcgcatc gctggttcct gcacgggata      1560
     ttcggatga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page