(data stored in ACNUC7421 zone)

EMBL: CP000690.PE20

CP000690.PE20        Location/Qualifiers
FT   CDS_pept        complement(25326..25595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3312"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28924"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ2"
FT                   /protein_id="ABQ28924.1"
FT                   /translation="MSDERPPLSPTEKIRDQLREALAAVNGLELEHSFGKLLDALHEAA
FT                   VNGVQLTEAHNQIIGLIRRRVETTWPETVFGYRGELEAPPDDEV"
     atgtctgatg aacgaccgcc cctttcgccc accgaaaaaa ttcgcgacca gctcagggag        60
     gcgctcgccg ctgtcaacgg gctcgagctg gagcacagct ttgggaagct gctcgatgcg       120
     ctgcatgagg ccgcggtcaa cggcgttcag ctgaccgagg cgcataacca gatcatcggg       180
     ctgatcaggc ggcgggtcga gacaacgtgg cccgagaccg tgtttggcta tcgcggtgaa       240
     cttgaggccc cgccggatga cgaagtctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page