(data stored in ACNUC7421 zone)

EMBL: CP000690.PE21

CP000690.PE21        Location/Qualifiers
FT   CDS_pept        25710..26090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3313"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28925"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ3"
FT                   /protein_id="ABQ28925.1"
FT                   /translation="MIYSPPARYAGPAIFAGHSMQKSIQTDDIPNIRLQVDTSIATLRK
FT                   LDDLRCRLGLSTYAEVIAAALKHEYAALEARRRLASAPTPPPPSSFSKRAAPEPVVPAA
FT                   PRPQVQARPAPQRVLALGGRER"
     ttgatttact cgcctccggc gcgatatgcc ggaccagcga tcttcgcggg acactcgatg        60
     caaaaatcca tccagaccga cgatattccg aatattcgat tgcaggtcga cacctcgatc       120
     gcgacgctga ggaagctgga cgatctgcga tgccggctgg gcctgtcgac gtatgccgag       180
     gtgatcgcgg cggcgctgaa gcatgagtac gccgcgctcg aagcccggcg ccggcttgca       240
     tccgctccga cgccacctcc accgtcgagc ttctcgaagc gggccgcgcc tgagccggtc       300
     gtgccggccg ccccgcgtcc ccaggttcag gcgcggccgg cgccacagag ggtgctggcg       360
     ttgggtgggc gagaaaggtg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page