(data stored in ACNUC7421 zone)

EMBL: CP000690.PE22

CP000690.PE22        Location/Qualifiers
FT   CDS_pept        26164..28842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3314"
FT                   /product="CRISPR-associated helicase, Cas3 family"
FT                   /note="TIGRFAM: CRISPR-associated helicase Cas3; PFAM:
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3314"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28926"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ4"
FT                   /protein_id="ABQ28926.1"
FT                   /translation="MLLPNSWQNVLAFWGKSYTREDKLFAYPIVAHSLDVAAAGSHLPM
FT                   PLKEFDKRTVYFLLSLHDIGKFSRPFQAQESDLWPSRVLGPWPGRVAGPRHDALTAALL
FT                   EVFADEGLLDPVFPLGRRGSGWHPSKRSGLIRTIAGHHGRPIDVPDHLEPAVCRQCLDA
FT                   AREFVQAMLDLFQPSPLPPPQSRRASARMQWQIAGFLTLADWIGSNEIWFPRDGTHSDL
FT                   DPHDYFREVALPRAAQAGADAGLTPSKARTFTGFSALFPKVDTPSPAQSWAETVPLPEG
FT                   AVLAIIEDLTGSGKTEAALTLASRIMASGEAKGIFFALPSMATANSMFQRLTDTYLRLF
FT                   EKGSRPSIALTHGKAGLDPRFRALISASPSSASEPREGEAIPSEAECAAWLAEDRRRSL
FT                   FADVGIGTIDQALLAVLPVRHAPLRLHGLQGKVLVVDEVHAFDSYMDRELQALLEFHAA
FT                   LGGSAILLSATLPLRMRQSLTDAFRRGAGQEAPRQVTSMHYPLATMVGSEAHTEYSLGV
FT                   RAGLPRSVTITRVGTEAEALSRVVDAARLGAAVVWIRNSVDDALEAAAAVRMQNIDPIV
FT                   FHARFAHCDRQSIELEVLRRFGKESVGQARAGVLIATQVVEQSLDLDFDLLVTDLAPVD
FT                   SLIQRAGRLWRHNRGTRVVGRPEMVVLSPEPSMDADAGWLDPLLPRTNNVYRNPALLWR
FT                   GARALFAKSDLVTPGDMRPLIEAADNVADTPPGLKMAADGAWAKHLSHRAFAAGAVLDF
FT                   DEGYTLQSGAWDRETRTPTRLEEREQATLRLARVKDGKVVPYAGLAGDLRQAWTLSEVR
FT                   VQRYRIAACPPPAGYSEAANEARSQWGRWERESPHMLLAILEVTKQEGQLMLKGEKPDG
FT                   HPVSAIYDAVDGLRLLPASAG"
     gtgttactgc ctaatagttg gcaaaatgta ttggcatttt ggggcaaatc atacactcgt        60
     gaggataagt tatttgctta tccgattgtg gcgcactcac ttgatgttgc tgcggcaggt       120
     tcacacctgc caatgccatt aaaggaattc gataagcgca cggtttactt cctgctgtcg       180
     ctccacgata tcggcaaatt ctcccgcccg ttccaggctc aggaatccga tctttggccg       240
     agccgggttc tggggccatg gcccggtcgt gttgcgggcc cgcgacacga tgcactgact       300
     gcggcactcc ttgaggtgtt cgcggacgaa ggtttgcttg acccggtatt cccacttggt       360
     cggcgaggga gcgggtggca ccccagcaag cgatctggtc tcattcgaac gattgccggg       420
     catcatgggc gtcccatcga tgtgcctgac cacctggagc ccgcggtttg ccgccaatgc       480
     ctggacgccg cccgggagtt cgttcaggcg atgctcgatc ttttccagcc gtctcccttg       540
     ccaccacctc aaagccggcg ggccagtgca cggatgcaat ggcaaattgc cggcttcctc       600
     actctcgccg attggattgg ctcaaacgaa atctggttcc cgcgcgatgg gacccacagc       660
     gatctcgatc cgcacgatta tttccgagaa gtagcgctgc cgcgcgccgc ccaagctggt       720
     gcggacgccg gactgacccc ctccaaggcg cgcactttca ctggcttctc cgcactgttc       780
     ccgaaggtcg acacaccgtc tccggcacaa tcatgggccg agacagtgcc gctgccggag       840
     ggggcagtgc tcgcaatcat cgaagacctg accggcagcg ggaaaaccga ggcggccctt       900
     acgcttgcca gccgtataat ggcatcggga gaggcaaagg gtatcttctt tgccctgccg       960
     agcatggcga ccgccaattc catgttccag aggctgaccg acacctacct gcgcctgttt      1020
     gaaaagggct cgcggccatc gatcgcactg acgcacggga aggccggtct ggatcctcgt      1080
     ttccgtgcgc tgatatcagc ctccccctcc tcggcttcag agccacggga gggggaggcg      1140
     attccgtcag aggcggagtg cgcagcctgg ctcgcggaag atcggaggcg ttccctcttt      1200
     gccgatgtcg gcataggcac catcgatcag gctctcctcg ccgtcttgcc cgtacgccac      1260
     gcgccgctcc ggctgcatgg cttgcagggc aaggttcttg tcgtggacga ggtacatgca      1320
     ttcgattcct atatggatcg cgaattgcag gcgctgctcg agtttcatgc cgcactgggt      1380
     gggtcggcga tactgctttc cgccactctc ccgctgagga tgcggcaatc gctgactgac      1440
     gcgttccgcc gtggcgccgg ccaggaagcc cctcgccagg ttacatcgat gcactacccg      1500
     ctcgccacca tggtggggtc tgaagcccat accgagtatt cgctgggcgt ccgggcgggc      1560
     ctcccccgtt cagtcaccat tacgcgggta ggcaccgagg cggaggccct ttcccgggtt      1620
     gtggacgccg caaggctagg cgctgccgta gtgtggatcc gaaacagcgt tgatgatgcg      1680
     ctcgaagccg ccgcggcggt gcgcatgcag aacattgatc cgatcgtctt tcacgcccgt      1740
     tttgctcact gcgaccggca gtcgatagag ctggaggtat tgcgccggtt cggcaaggag      1800
     agtgtcgggc aagcgcgcgc cggcgtcctg atcgccaccc aggtcgtcga gcagtccctg      1860
     gatctggatt tcgacctgct ggtgacggac ctggcaccgg tggacagcct catccagaga      1920
     gctgggcggc tttggcgcca caatcgcggg acgcgcgtcg tcggccgccc tgaaatggtt      1980
     gtcctctcgc ctgagccatc aatggatgcc gacgcgggct ggcttgatcc gctgctgccg      2040
     cggaccaaca acgtctaccg aaatccggcg ctgctctggc gcggcgcccg ggcgctattc      2100
     gccaaatccg acctcgtcac acccggtgat atgcgccccc tgatcgaggc ggcggataac      2160
     gtggcggata cgcctccggg cctcaagatg gcggcggacg gagcatgggc aaagcatctg      2220
     agccaccgtg cgtttgcggc cggcgccgtg ctggatttcg acgaggggta tacgctccaa      2280
     tccggtgcct gggacaggga aacccggaca ccgacccgac ttgaggagcg cgagcaggca      2340
     acgcttcgcc tggctcgcgt caaggatgga aaggtggtgc cctatgctgg gcttgcggga      2400
     gacttgcggc aggcgtggac gttatccgaa gtgagggtcc agcggtatcg gatagcagcc      2460
     tgcccaccac cggcgggata ttccgaagcg gcgaacgagg cgcggagcca atgggggcgc      2520
     tgggaacgcg agagccccca catgctgctc gccattctcg aggtgacgaa gcaggagggc      2580
     cagcttatgc tgaagggcga aaagccggat ggccatcccg tttcggcaat ctacgatgct      2640
     gttgatggcc tgagactgct tcccgcatcc gcgggatga                             2679
//

If you have problems or comments...

PBIL Back to PBIL home page