(data stored in ACNUC7421 zone)

EMBL: CP000690.PE23

CP000690.PE23        Location/Qualifiers
FT   CDS_pept        29133..30722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3315"
FT                   /product="CRISPR-associated protein, Cse1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3315"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28927"
FT                   /db_xref="InterPro:IPR013381"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ5"
FT                   /protein_id="ABQ28927.1"
FT                   /translation="MFNLLTNPWLPIVRQDGTKSVIAPRGITEDISANPVIAVDWPRAD
FT                   FRLATMELLAGLIATACPPADEDDWLDAWEAPPSPEKLDGALAPLSHAFSFDGPGPRFM
FT                   QDLADLDADEEPVENLLIEVAGNSGPLVHPGRTKRMGRPAAAISLYTLQSWSPSGGRGN
FT                   RTGLRGGGPMVTMVAPGRHRSLWHHIWANVPLGRKPEPVDFPRIFPWLSPTITSVNDEV
FT                   VTPDDVAHPLQVWWGMPRRIRLSFVQLPSPAPCDLTGALDSSVVTGWRQRPHGPQYVGW
FT                   GTRHPLTPTYQNKAGEEILSVHPNPGGVGYRNWIGLVLRSPDGLRRPAPIVSTWRNDRY
FT                   RGTEEAKGARLIAGGYDTDNMKARGFMETEVPLVLASSKEVQERLDALATSLVRASERA
FT                   SYQLRKAVQQALYHPGAKVKATAHGIALLGDRVWLETESAFFSALHRAMSLDDTAPERV
FT                   AWQARLRGLALRIFDDTVPIDPLDRNNVRQVRARFFLGLGLSGYGKDGQSFFQILEMPL
FT                   PAQEKKSKGKAS"
     atgtttaacc tcttgactaa tccatggctc cccattgtcc gtcaggacgg gacgaaaagt        60
     gtcatcgccc ctcggggcat cacggaggat atttccgcga acccagtcat tgccgtcgac       120
     tggccgcgcg ccgattttcg tctcgccacg atggaattgc tggctggcct aatcgccacg       180
     gcctgccctc cggcagatga ggatgattgg ctcgacgcct gggaagctcc tccttcgcct       240
     gaaaagttgg acggtgcctt agcgccattg tcccatgcat tcagcttcga cggccctggg       300
     ccccgcttca tgcaagatct tgcggatctc gacgctgatg aagagcccgt ggaaaatctg       360
     ctaatcgagg tggccggtaa ttccggtccc ctcgttcatc cgggacgcac caagcggatg       420
     ggcaggccgg cggcagcaat ctccctttac acgctgcaat catggtcgcc ctccggcggg       480
     aggggcaacc gtacaggctt gcggggaggg ggaccgatgg tcaccatggt ggcgccaggc       540
     cggcatcgat ctctctggca ccacatctgg gccaatgtgc cgctcggacg aaagcccgag       600
     ccggtagact ttcctcgtat ctttccttgg ctctcgccaa cgatcacatc cgtgaacgat       660
     gaggtcgtaa cgccagatga tgtcgcccac cccctgcaag tctggtgggg tatgccgcgg       720
     cgtatcaggc tcagcttcgt tcagctgcct tcacctgccc cttgcgacct gacaggtgct       780
     ttggactcga gcgttgtcac cggatggcgg cagcgccccc acgggccaca gtatgtcggg       840
     tggggaacga gacatcccct cacaccaacc tatcagaaca aggctggaga agagatttta       900
     tcggtccacc ctaaccctgg tggagtcggt taccgaaact ggattggtct cgttctccgc       960
     agcccggacg gcctgcgccg gccggcaccc atcgtctcta cctggcggaa tgaccgctac      1020
     cgcggcacgg aagaagccaa aggtgcccgc cttatcgctg gcggctatga cacggacaac      1080
     atgaaggcgc gaggcttcat ggagaccgag gtcccgctgg tcctggcgag ctcgaaggag      1140
     gtgcaggaac gtctggacgc attagccaca tcgcttgtcc gtgccagcga gcgggccagc      1200
     taccagctcc gcaaggctgt gcaacaggca ctgtatcatc caggcgcgaa ggtcaaagcc      1260
     acggctcatg ggatcgcgct tctgggggac cgcgtttggc tggagacgga gagcgcgttc      1320
     ttcagtgctt tgcaccgcgc gatgagcctt gacgatacgg cgccagaacg ggtcgcatgg      1380
     caggcgcgcc ttagaggtct cgcgctgcgc atcttcgacg acaccgtgcc gattgatcca      1440
     ctggacagga acaatgttcg gcaggtcaga gcgcgctttt tcctcgggct cggccttagt      1500
     ggctacggca aagacggcca gtcctttttc cagatcctgg aaatgcccct gccagcccag      1560
     gaaaaaaagt cgaaaggaaa ggcttcatga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page