(data stored in ACNUC7421 zone)

EMBL: CP000690.PE24

CP000690.PE24        Location/Qualifiers
FT   CDS_pept        30719..31258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3316"
FT                   /product="CRISPR-associated protein, Cse2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3316"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28928"
FT                   /db_xref="InterPro:IPR013382"
FT                   /db_xref="InterPro:IPR038287"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ6"
FT                   /protein_id="ABQ28928.1"
FT                   /translation="MIRYRSAAHDWWRDLVPRAGYPGDRAAVAKLRRASTISEAITEEA
FT                   SIALFRRVGATSAEDLPRVALAAAILARVSKEPDGPNAPRSVARVLGPQKTDDVSTAIL
FT                   SPLRFKRLLAVDEPEEQLIAFRRMVAIARGSLPVRDLADALLDWSETRRRRWVFDYWNA
FT                   SEIASTPTTDTPEEPV"
     atgatccgtt atcgatcggc cgcccatgac tggtggcggg atctcgttcc gcgggcaggc        60
     taccccggtg accgtgctgc ggtcgccaag cttcgccgcg cgtcgaccat cagcgaagca       120
     atcacggaag aagcatctat cgcgctcttc cgccgcgtcg gggcgacatc ggctgaagat       180
     cttccccgtg tggcactcgc cgcggccata ctggcccgcg tgagcaagga gcccgacggc       240
     cccaatgccc cccggtcggt cgcgcgcgtt cttgggccgc aaaagacaga cgacgtttca       300
     acggccatcc tctcgccgct tcgcttcaag cgcctgctgg ctgtagacga accggaagag       360
     cagctgatcg cctttcgccg gatggttgcc atagcacgcg ggtcccttcc tgttcgtgac       420
     ctggctgacg ccctgctgga ctggtcggaa acccgccgcc gccgctgggt gttcgattac       480
     tggaacgcaa gcgaaatcgc ctccacccct acaaccgata cccccgagga gcccgtgtga       540
//

If you have problems or comments...

PBIL Back to PBIL home page