(data stored in ACNUC7421 zone)

EMBL: CP000690.PE25

CP000690.PE25        Location/Qualifiers
FT   CDS_pept        31258..32370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3317"
FT                   /product="CRISPR-associated protein, Cse4 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3317"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28929"
FT                   /db_xref="InterPro:IPR010148"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ7"
FT                   /protein_id="ABQ28929.1"
FT                   /translation="MTQFLQVHLLTFFPPSNMNRDDTGRPKTAMVGGAMRLRLSSQALK
FT                   RAWRTSTIFSEALKGYMGERTQRLGEEILKTLQAEGVSEVQALAVARAVAGQFGKLNED
FT                   ETPARIQQLAFISPDERKAAFDLARRYAAGELPLPEKAKGKRGKANKTEGEEEVEAPEI
FT                   LLLRESDTAADIALFGRMLADKPAFNREAAAQVAHAITTHRISVDDDYYTAVDDLKRPS
FT                   EDAGAGFIGETGFGSGVFYTYMSINIDLLIRNLGGGDQARDLAATAIAALVEAAATTAP
FT                   SGKQNSFAAHGRAGYILAERGKAQPRTLAGAFAKPVEGGDIMDASIGRLEEFREAIDKA
FT                   YGPTADATKVMRVGGEGSLADIIVFAREGV"
     atgacccagt ttttgcaggt ccatctcctg accttcttcc cgccttcgaa catgaaccgc        60
     gatgacactg ggcgcccgaa aaccgccatg gtcggcgggg caatgcgcct tcgcctgtcc       120
     tcccaggcgc tcaagcgcgc ctggcgcacg tccacgatat tctccgaggc cctcaaagga       180
     tacatgggag agcgcacgca gcgcctcggg gaggagattc tcaaaaccct gcaggccgag       240
     ggggtttccg aggttcaggc gctcgccgtc gcccgcgccg ttgccggcca gttcggcaag       300
     ctgaacgagg acgaaacgcc ggcgcgcatc cagcagcttg cgtttatttc gcccgatgag       360
     cgcaaggctg ccttcgacct ggcccggcga tatgctgccg gtgagcttcc tcttcccgaa       420
     aaggccaagg gcaagagggg caaggcgaat aagaccgagg gcgaggaaga ggtggaagcg       480
     cccgaaatcc tgctgctccg cgaaagcgat accgcagccg atattgccct tttcggccgc       540
     atgctggccg acaagccggc cttcaaccgt gaagccgccg cacaggtggc acatgccatc       600
     accacccatc gcatcagcgt ggacgacgac tactacacgg ctgtcgatga tctgaagcga       660
     ccgtccgagg acgccggcgc tgggttcatc ggagagaccg gcttcggcag tggagtcttc       720
     tacacgtaca tgtcgatcaa tatcgacctc ctgatccgga acttgggcgg cggtgatcag       780
     gcacgagacc tggctgccac cgccattgct gctcttgtcg aggcggcagc caccaccgca       840
     ccgagcggca agcagaacag cttcgccgcc cacgggcggg ccggatacat cctcgccgag       900
     cgcggaaagg cgcagccgcg aactcttgcg ggtgccttcg ccaaacccgt cgaagggggc       960
     gatatcatgg acgcgtcgat tggccggctc gaggaattcc gggaagcgat cgacaaggct      1020
     tacgggccga cggccgatgc gacaaaggtc atgcgtgttg gtggcgaggg ctctctggct      1080
     gacatcattg tcttcgcccg cgaaggagtg tga                                   1113
//

If you have problems or comments...

PBIL Back to PBIL home page