(data stored in ACNUC7421 zone)

EMBL: CP000690.PE26

CP000690.PE26        Location/Qualifiers
FT   CDS_pept        32372..33121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3318"
FT                   /product="CRISPR-associated protein, Cas5e family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas5 family;
FT                   CRISPR-associated protein Cas5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3318"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28930"
FT                   /db_xref="GOA:A5FTJ8"
FT                   /db_xref="InterPro:IPR010147"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="InterPro:IPR021124"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ8"
FT                   /protein_id="ABQ28930.1"
FT                   /translation="MKRFLTFTLFAPIASFGAIAVGERRESWSRPARSAVLGLVGACLG
FT                   IEREDAEEQAALERDFGFALLCGTSGGPLADFHTLQVGRPARGQTFRTRAEELNSNTVD
FT                   TILTRRDYRVSAWHLAALWVRSVVDPRWALEDLADAMKQPAFTPYLGRRACPLGLPLAP
FT                   QIIDADSPASALDRRWASGPEAEFRPSLAGTIQDLFVARDRWVGDEGANNLLRSEERRD
FT                   APISRTLWQFGLRTEVIEAFSPTENRS"
     gtgaagcgct tcctcacgtt caccctgttc gcccccatcg cctcctttgg cgctattgcc        60
     gtgggggagc ggcgcgagag ctggtcgcgc cccgcacgat cggccgtgct cggtctcgtg       120
     ggagcatgtt tgggcattga gcgggaagat gcggaagagc aagctgccct cgagcgtgac       180
     tttggctttg ccttgctctg cggcacgtca gggggcccgc ttgccgattt tcacacgctc       240
     caggtcggcc gcccagcccg tggtcagacg ttccgcacgc gggctgagga gcttaactcg       300
     aataccgtcg acacgattct cacacggcgt gactaccgtg tgagcgcctg gcatcttgca       360
     gcactctggg tacggtcagt ggtggatccc cgctgggcgc ttgaggatct agccgacgcg       420
     atgaagcagc cagccttcac accctacctc gggcgacgcg catgcccgct cggcctcccc       480
     ctcgcgccgc agatcatcga tgccgacagc ccggcatcgg ccctggacag gcgatgggcc       540
     agtggccccg aggctgaatt ccgtccatcg ctcgccggca cgatccagga tctgttcgtg       600
     gcgcgcgacc gatgggtggg agacgagggg gcgaacaacc tgctccgcag cgaagagcgg       660
     cgggatgccc cgatctcgcg caccctatgg caattcggcc tgcgcacaga ggtcatcgag       720
     gcattttctc caacggagaa ccggtcatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page