(data stored in ACNUC7421 zone)

EMBL: CP000690.PE27

CP000690.PE27        Location/Qualifiers
FT   CDS_pept        33127..33804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3319"
FT                   /product="CRISPR-associated protein, Cse3 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Cse3 family;
FT                   PFAM: CRISPR-associated protein, CT1974"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3319"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28931"
FT                   /db_xref="InterPro:IPR010179"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTJ9"
FT                   /protein_id="ABQ28931.1"
FT                   /translation="MWLSKARLNHDQKAVAALASVLVPEDGSARVAATHHLVWSLFAGD
FT                   ADRKRDFLWREERPGHFLILSPDRPGDGGGLCTVESKEFTPALSAGDRLGFSLRANAVV
FT                   SRGEPGSGRGKRHDVVMDVLRHHPKGERASHRLGLVTEAGAAWLVRQGERHGFVIEGQP
FT                   ACDGYEAIRVLRGRGEKPLTFSQIDFAGVLSVTDPARFIAAIGHGFGRARAFGCGLMLI
FT                   RRV"
     atgtggctgt caaaggcgcg cttgaaccac gatcagaagg cggtcgcggc cctcgcttcg        60
     gttctggtgc ctgaagacgg ctcggcccgg gttgcggcga cgcatcatct cgtctggtca       120
     ctttttgccg gagacgcgga tcggaagcgc gacttcctgt ggcgtgaaga gcgtccgggc       180
     cattttctta tcctctcgcc cgaccggcca ggcgacgggg gcgggctctg cacggtcgag       240
     agcaaggaat tcacaccggc gttgtcggcc ggcgacaggc ttggcttttc cctgcgtgcg       300
     aacgcggttg taagccgggg agagcccggc tccggccggg gcaagcgtca tgacgtcgtg       360
     atggatgtcc ttcgtcatca tcctaagggc gagcgtgcat ctcatcgcct gggtctggtc       420
     accgaggccg gagcggcctg gcttgtccgc cagggtgaac gtcacggttt cgtaatcgaa       480
     ggccagccgg cctgcgatgg ctacgaggca atccgggtgt tgcgtggaag gggtgagaag       540
     cctctgacct tcagccagat tgatttcgcg ggagttttaa gcgtcaccga tccagcgcgc       600
     ttcatcgctg ccattggcca tggcttcggg cgggcgcggg cctttggctg tggcctcatg       660
     ctgatccgcc gtgtctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page