(data stored in ACNUC7421 zone)

EMBL: CP000690.PE28

CP000690.PE28        Location/Qualifiers
FT   CDS_pept        33797..34759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3320"
FT                   /product="CRISPR-associated protein, Cas1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3320"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28932"
FT                   /db_xref="GOA:A5FTK0"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019851"
FT                   /db_xref="InterPro:IPR033641"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK0"
FT                   /protein_id="ABQ28932.1"
FT                   /translation="MSDQAPGLPPPRPIPIRERSSILFLERGQLDVIDGSFVVVDQRGI
FT                   RTVIPVGGITCLMLEPGTRVSHAAVCLAARAGTLLIWVGEAGVRLYAAGQPGGARSDRL
FT                   LYQARLALDDEARLRVVRRMYSIRFQEEPPQRRSVDQLRGIEGVRVRELYKLMAQRHGV
FT                   SWAGRRYDPQNWGGADLVNRCLSAATAALYGISEAAILAAGYAPAIGFLHSGKPQSFVY
FT                   DIADLFKFETVVPEAFKVVAAVQSGRGQIDGMAIGEPVGAVRRRCRDAFRRTNVLARII
FT                   PAIEDVLAAGGLAVPEAPEEAMPVAIPPPEPTGDAGHRG"
     gtgtctgatc aggcgccggg tctgccgccg ccgcgaccca ttccaattcg tgaacgctca        60
     tctatcctgt ttctcgagcg cggacagctt gacgtaatcg atgggagctt tgttgtcgtc       120
     gaccagcgtg gcattcggac cgtaattccg gtcggcggca ttacatgcct gatgctggag       180
     ccaggcacac gtgtaagcca tgccgctgtt tgcctagctg cacgagcggg cacattactc       240
     atctgggttg gagaggctgg tgtgcgcctc tacgctgccg gccagccggg tggtgcgcgg       300
     tccgaccggc tactctatca ggcacgactt gcgctcgatg atgaggctcg tctccgtgtc       360
     gtacgaagaa tgtattctat ccgttttcag gaggagccgc ctcaacgccg ctctgtcgat       420
     caactgcgcg gcattgaggg cgtccgcgtg cgggagctct ataagctgat ggcccagcgc       480
     catggcgtct cctgggccgg gcggcgttac gacccccaga actggggtgg tgctgatctt       540
     gtcaatcgtt gtctatctgc tgcgacagct gccctatacg ggatctcgga ggcggcaatc       600
     ctggccgccg ggtatgcgcc ggcgatcggc tttttacata gtggcaagcc gcaaagcttt       660
     gtttatgaca ttgcggatct cttcaagttc gaaacggtcg tgccggaggc attcaaggta       720
     gtggcggcag tgcaatctgg acgtggacag attgatggga tggcgatcgg agaacctgtc       780
     ggcgcggtcc ggcggcgctg ccgcgatgcg ttccgccgca caaatgtact cgcacgcatc       840
     attcccgcta tcgaggatgt gttggcagcc ggcggcttgg cagtgccaga ggcgcccgaa       900
     gaagcgatgc ccgttgctat accaccaccg gaaccgacgg gtgatgctgg tcatcgtggt       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page