(data stored in ACNUC7421 zone)

EMBL: CP000690.PE29

CP000690.PE29        Location/Qualifiers
FT   CDS_pept        complement(38112..40184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3321"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28933"
FT                   /db_xref="InterPro:IPR004322"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK1"
FT                   /protein_id="ABQ28933.1"
FT                   /translation="MVKSAVVQIARPAPARRRSGLRLRMLGRTIANEYFYRGGSAARRG
FT                   PTGADVASRRISPDEWHDYTLAISCARRAMSKLKRDAIMASRRHDRPDDDDLVEMIEKR
FT                   RHLRAEVKKRIGAGLVLEPDISCGAFVDGVKLRGFRSSLDPILKLFVSKLCKGRYTRRG
FT                   SRLPSISSSRDKASIFPCPSKALALDDEYVTFNPMMRGVFRVDLDRDFASTEECQEKIR
FT                   ELRLPAPNIITGVSTSGGKLRRPHVYFVVKHSVCFTGNGRNGAKALFKLIGTILTERLA
FT                   PLGADRFATNTLRGKNPLCERLTTAVVYSEPYSLGFDPHGCESLADLLDLGQYRGKFSN
FT                   FGAAEDMLLRDGRRGSNAVFRTVGRLCARLVHEFHPESPRRSARYRANLVGTDHALEDF
FT                   EDAVLRGAQQYFEDCEQLRRQCAKSARYFFTRYDARIASANRRRGAMAAEPEYLAALSK
FT                   REKQQAGGRYAALKCKEATLIRLAVAAEEIGHLAEDIGVSELARASGVSRMTIYRHRHE
FT                   LERGRYLLAEMRENGAAQGDHTIHAGPTSDCNIQCLDKRDTGKSGSLEEMGTPGAEHPE
FT                   GVTQSRRQFIKRRGSRFMGSKSGKVRVHALNPVFILEIPGGSGAKRPRIVRIRDDVDEL
FT                   AYEAAVEPTIRFIDDFGRERMGNEPVIYAHNGAVAWKNPDFADRRNLNSANRRSS"
     atggtaaagt ctgccgtcgt ccagattgcc aggccagccc cggcacgccg tcgctcagga        60
     ttgcgcctga ggatgctcgg tcgaacgatt gccaacgagt atttctaccg gggtggcagc       120
     gccgcgcggc gcggtccgac cggtgcggat gttgcgagcc ggcgcatatc gccggacgag       180
     tggcacgact acaccctggc catctcctgc gcccgccgtg ccatgagcaa gttgaagcgt       240
     gatgcgatca tggcatcgcg tcgtcatgat cggccagatg atgacgacct ggtggagatg       300
     atcgagaagc gccgccacct ccgcgccgag gtaaaaaagc gcatcggagc cggcttggta       360
     ctcgagcctg acatctcgtg cggcgctttc gttgacggcg ttaagctgcg tggcttccga       420
     tccagtctcg atccgatcct caagctgttt gtttcgaagc tctgcaaggg acgatacacg       480
     cgtcggggca gcagactgcc gtcaatctcg tcgagtcgtg acaaggcgag catcttcccg       540
     tgcccgagca aggccctcgc gctcgacgac gaatatgtca cattcaatcc catgatgcgt       600
     ggcgtgttca gggtcgatct cgacagggat tttgcttcaa cggaagaatg tcaggagaaa       660
     atccgcgaac tgaggcttcc cgcgccgaac atcatcaccg gggtttccac cagcggtggc       720
     aagctgcgca ggccgcacgt ctacttcgtc gtaaagcaca gcgtgtgctt tacaggaaat       780
     gggcggaatg gggcgaaagc cctcttcaag ctgatcggca cgatcctgac cgagcgcctg       840
     gccccgcttg gagccgaccg cttcgctacc aacaccctgc gcggcaagaa cccgctctgt       900
     gagagattga cgactgctgt cgtctacagt gagccgtata gtctcgggtt cgatccgcac       960
     ggttgcgaga gtctcgccga cctgctcgat ctcggccaat atcgaggaaa gttttcgaat      1020
     ttcggcgctg ccgaggatat gctcctgcgc gatggccgcc ggggctcgaa cgcggtcttc      1080
     aggaccgtag gccggctgtg cgcacggctc gtccatgaat ttcatccgga atccccgcgc      1140
     cggtcggccc gctaccgggc aaatctcgtc ggcacggacc acgccctcga ggacttcgag      1200
     gatgctgtcc tgcgcggcgc gcagcagtac ttcgaagact gcgagcagct gcgcagacag      1260
     tgcgccaaga gtgctcgcta cttcttcacc cggtacgacg cgcggatcgc atcggccaat      1320
     cgccggcgtg gcgccatggc cgccgagccg gagtatctcg ccgcgctctc caagcgcgag      1380
     aagcagcagg cggggggtcg ctacgcggcg ctgaagtgca aggaggcgac cctgatccgg      1440
     ctcgccgtcg ccgcagagga aatcggccac ctcgccgagg atatcggagt gtctgagctc      1500
     gcgcgcgcct ccggtgtctc caggatgaca atctaccgcc acaggcacga gctcgagaga      1560
     gggcgttatc tactcgcgga aatgcgggaa aacggggccg cgcagggtga tcacacgata      1620
     cacgcaggtc ccacatccga ctgtaacatc cagtgcttgg ataaaaggga tacgggtaaa      1680
     tcgggatcgc tagaagaaat gggcaccccg ggggcggaac atccggaggg cgtcacccag      1740
     tccaggcgtc agttcataaa gcgtcgtggc tcgcgattta tgggatctaa aagcggaaaa      1800
     gtccgggttc atgcgctaaa tcccgtattt atcctcgaaa ttcccggtgg atcaggcgca      1860
     aagcgccctc gcatcgtcag aattcgtgac gacgtggacg aactcgcata tgaagccgcg      1920
     gtcgagccca caattcgatt tattgacgat ttcggccgcg agcgtatggg gaatgagcct      1980
     gtgatttacg cccacaacgg cgctgtcgca tggaaaaatc cagattttgc tgacaggcgt      2040
     aacctgaatt ccgccaacag acgcagtagt tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page