(data stored in ACNUC7421 zone)

EMBL: CP000690.PE30

CP000690.PE30        Location/Qualifiers
FT   CDS_pept        complement(40187..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3322"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28934"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK2"
FT                   /protein_id="ABQ28934.1"
FT                   /translation="MIDGQEHDVAAEIRIPLIEGAFFAARDRLASELATSGFDPHVAAA
FT                   GANQIGEAILESPTQNEDAAWLIAAMAPAGIARRLAGTDARNTRAALIRDGIAPDIARA
FT                   VVQIAPVSPRGPQAALRQLTRVADAMRVGMDAVVEAMRGRLVDSLAARGIVPKVAREIS
FT                   AALPKAAMRADLHLSEAIANQAAYVLETHPKLGAMSAVHGVIAYRRLGESAAMNQLIHD
FT                   LRYAPAVAAAPEPMPAGVMEAIELSQRAVDANLANANRVYVEALDDSPKPGS"
     atgatcgacg gtcaggagca cgacgtggcg gcagagatcc ggatccccct catcgagggc        60
     gccttcttcg ccgcgcgcga ccggctcgcc tcggaactgg ccacctccgg ctttgatccc       120
     catgtcgcgg ccgccggcgc caaccagatc ggcgaggcca tcctcgagag tccgacccag       180
     aacgaggatg cagcctggct gatcgccgcg atggcgccgg ccggcatcgc ccgccggctt       240
     gccgggactg acgcgcgcaa cacccgtgcc gccctgatcc gggacggcat cgcgccggac       300
     atcgcccgtg ccgtcgtcca gatcgccccc gtctcgccgc gcggcccgca ggcggccctt       360
     cgtcagctca cccgtgttgc cgatgccatg cgtgtcggca tggacgcggt ggtcgaggcg       420
     atgcgcggcc gcctggtcga cagcctcgcc gcccgcggca tcgttccgaa agtggcccgc       480
     gagatttcgg cagcactgcc caaggcggcg atgcgcgccg atctgcacct ctccgaggcg       540
     atcgccaacc aggccgccta tgtgctggag acccatccga agctgggcgc catgtccgcg       600
     gtgcacggcg tgatcgccta tcgccgtctc ggcgagtccg ccgccatgaa ccagctgatc       660
     cacgacctgc gctacgctcc cgcggtcgcg gcggcgcccg agccgatgcc ggccggcgtc       720
     atggaagcga tcgagctgtc ccagcgcgcc gtcgatgcca atctcgccaa cgccaaccgg       780
     gtctacgtcg aggcactcga cgacagcccg aagccgggga gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page