(data stored in ACNUC7421 zone)

EMBL: CP000690.PE31

CP000690.PE31        Location/Qualifiers
FT   CDS_pept        complement(41008..41421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3323"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28935"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK3"
FT                   /protein_id="ABQ28935.1"
FT                   /translation="MSARARKTGGLLLGILRVEGAPAQTRYELFPDEQGLIRWRRAMLR
FT                   RNWREWVAPAIDSAIAEGQLHDVRLLISDPEMLTDRQVDEVSLLYKIAVTFEAIPNMTV
FT                   LRDEPVAVRDQLSLFGDESEAVEADPLMAGPSP"
     atgtctgcgc gcgcccgcaa aaccggtggc cttttgctcg ggatccttcg tgtcgaggga        60
     gctccggccc agacgcgcta tgaactgttc cccgacgagc agggcctgat ccgctggcgg       120
     cgcgcgatgc tgcggcggaa ctggcgcgaa tgggtcgcgc cggcgatcga ctcggccatc       180
     gcggaaggtc agcttcatga cgtccgcctt ctcatctccg atccggagat gctgaccgac       240
     cggcaggtcg acgaagtgtc gctgctatac aaaattgccg tgacttttga agctataccc       300
     aatatgaccg ttctccggga tgagcctgtc gccgtgcgtg accagctcag cctgttcggt       360
     gacgagagcg aggcggtcga ggccgatccg ctcatggccg gaccctcacc atga             414
//

If you have problems or comments...

PBIL Back to PBIL home page