(data stored in ACNUC7421 zone)

EMBL: CP000690.PE32

CP000690.PE32        Location/Qualifiers
FT   CDS_pept        41657..42250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3324"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: regulatory protein, MerR; Resolvase,
FT                   N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3324"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28936"
FT                   /db_xref="GOA:A5FTK4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR041718"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK4"
FT                   /protein_id="ABQ28936.1"
FT                   /translation="MLGVSITTLRRWEAAGKLVADHTAGGHRRYDIAKLRPDLFHAEDE
FT                   ADRRTIAYARVSSHDQKDDLERQKQVLELYCARQGWKFEIVADLGSGMNYRKKGLKKLL
FT                   GAIIDGSVGRLVIAHKDRLLRFGADLVFAICEAKNVEVVILNQGEDTTFEEDLAKDVLE
FT                   IITVFSARLYGSRSHKNQKLLDGVKRAVEESAAC"
     atgctgggtg tgtcgatcac aaccctgcgg cgctgggagg cagcaggaaa gctggtcgcc        60
     gaccacaccg cgggcggcca tcgccgctac gacatcgcaa aactccggcc ggatctattc       120
     catgcggaag acgaggccga ccgccgcacc atcgcctacg cccgcgtgtc aagccacgac       180
     cagaaggatg atctggaacg gcagaagcag gtgctcgaac tctattgtgc tcgtcagggc       240
     tggaaattcg agattgtcgc cgaccttggg tcaggcatga actaccgcaa gaagggcctc       300
     aagaagttgc ttggagccat catcgacggc tcagtgggcc gattggtgat cgctcataaa       360
     gaccgcctgc ttcgattcgg ggcggatttg gtgtttgcca tctgcgaggc caaaaacgtc       420
     gaggtggtga tcctcaacca aggtgaggat acgaccttcg aggaagacct cgccaaggac       480
     gtgctggaga tcatcacagt gttttcagcg cggctctatg gctcacgctc acacaagaac       540
     cagaagctgc tggacggtgt gaagcgtgcc gtggaagaat ccgcggcatg ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page